DnaJ homolog subfamily C member 14 (DNAJC14) Recombinant Protein | DNAJC14 recombinant protein
Recombinant Human DnaJ homolog subfamily C member 14 (DNAJC14)
Gene Names
DNAJC14; DNAJ; HDJ3; LIP6; DRIP78
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily C member 14 (DNAJC14); Recombinant Human DnaJ homolog subfamily C member 14 (DNAJC14); DNAJC14 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-702aa; full length protein
Sequence
MAQKHPGERGLYGAHHSGGASLRTLGPSVDPEIPSFSGLRDSAGTAPNGTRCLTEHSGPK HTQHPNPAHWLDPSHGPPGGPGPPRDAEDPDQSETSSEEESGVDQELSKENETGNQKDGN SFLSIPSACNCQGTPGIPEGPYSEGGNGSSSNFCHHCTSPALGEDELEEEYDDEESLKFP SDFSRVSSGKKPPSRRQRHRFPTKEDTREGGRRDPRSPGRHRLGRKRSQADKRKGLGLWG AEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRQLKSSDLDLFRVWMGVWTGRLGG WAQVMFQFLSQGFYCGVGLFTRFLKLLGALLLLALALFLGFLQLGWRFLVGLGDRLGWRD KATWLFSWLDSPALQRCLTLLRDSRPWQRLVRIVQWGWLELPWVKQNINRQGNAPVASGR YCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRA EEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRC QGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEW AGCQRVGISPDTHRVPYHISFGSRIPGTRGRQRATPDAPPADLQDFLSRIFQVPPGQMPN GNFFAAPQPAPGAAAASKPNSTVPKGEAKPKRRKKVRRPFQR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for DNAJC14 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
78,569 Da
NCBI Official Full Name
dnaJ homolog subfamily C member 14
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C14
NCBI Official Symbol
DNAJC14
NCBI Official Synonym Symbols
DNAJ; HDJ3; LIP6; DRIP78
NCBI Protein Information
dnaJ homolog subfamily C member 14
UniProt Protein Name
DnaJ homolog subfamily C member 14
Protein Family
UniProt Gene Name
DNAJC14
UniProt Synonym Gene Names
DRIP78; HDJ3; DRIP78; hDj-3
UniProt Entry Name
DJC14_HUMAN
Uniprot Description
DNAJC14: Regulates the export of target proteins, such as DRD1, from the endoplasmic reticulum to the cell surface.
Protein type: Endoplasmic reticulum; Chaperone; Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 12q13.2
Cellular Component: endoplasmic reticulum membrane; integral to membrane; membrane; nucleolus; nucleoplasm
Molecular Function: dopamine receptor binding
Biological Process: protein transport
Research Articles on DNAJC14
Similar Products
Product Notes
The DNAJC14 dnajc14 (Catalog #AAA7013806) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-702aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the DNAJC14 dnajc14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQKHPGERG LYGAHHSGGA SLRTLGPSVD PEIPSFSGLR DSAGTAPNGT RCLTEHSGPK HTQHPNPAHW LDPSHGPPGG PGPPRDAEDP DQSETSSEEE SGVDQELSKE NETGNQKDGN SFLSIPSACN CQGTPGIPEG PYSEGGNGSS SNFCHHCTSP ALGEDELEEE YDDEESLKFP SDFSRVSSGK KPPSRRQRHR FPTKEDTREG GRRDPRSPGR HRLGRKRSQA DKRKGLGLWG AEELCQLGQA GFWWLIELLV LVGEYVETCG HLIYACRQLK SSDLDLFRVW MGVWTGRLGG WAQVMFQFLS QGFYCGVGLF TRFLKLLGAL LLLALALFLG FLQLGWRFLV GLGDRLGWRD KATWLFSWLD SPALQRCLTL LRDSRPWQRL VRIVQWGWLE LPWVKQNINR QGNAPVASGR YCQPEEEVAR LLTMAGVPED ELNPFHVLGV EATASDVELK KAYRQLAVMV HPDKNHHPRA EEAFKVLRAA WDIVSNAEKR KEYEMKRMAE NELSRSVNEF LSKLQDDLKE AMNTMMCSRC QGKHRRFEMD REPKSARYCA ECNRLHPAEE GDFWAESSML GLKITYFALM DGKVYDITEW AGCQRVGISP DTHRVPYHIS FGSRIPGTRG RQRATPDAPP ADLQDFLSRI FQVPPGQMPN GNFFAAPQPA PGAAAASKPN STVPKGEAKP KRRKKVRRPF QR. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily C member 14 (DNAJC14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
