Mdg-1 recombinant protein
Human Mdg-1
Gene Names
DNAJB9; MDG1; ERdj4; MDG-1; MST049; MSTP049
Reactivity
Human
Purity
> 95% by SDS-PAGE & visualized by silver stain
Synonyms
Mdg-1; Human Mdg-1; Microvascular endothelial differentiation gene 1 protein; DnaJ homolog subfamily B member 9; ERdj5; Mdg-1 recombinant protein
Host
E Coli
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE & visualized by silver stain
Form/Format
Lyophilized
Sequence
Protein Sequence: MKHHHHHHSAGLEVLFQGPMASKSYYDTLGVPKSASERQIKKAFHKLAMK YHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRG SGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQ RHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKH CRTVTQRRGNMVTTYTDCSGQ
Sequence Length
223
Species
Human
Related Product Information for Mdg-1 recombinant protein
Angiogenesis research has focused on receptors and ligands mediating endothelial cell proliferation and migration. Little is known about the molecular mechanisms that are involved in converting endothelial cells from a proliferative to a differentiated state. Microvascular differentiation gene 1 (Mdg1) has been isolated from differentiating microvascular endothelial cells that had been cultured in collagen type I gels (3D culture). In adult human tissue Mdg1 is expressed in endothelial and epithelial cells. Sequence analysis of the full-length cDNA revealed that the N-terminal region of the putative Mdg1-protein exhibits a high sequence similarity to the J-domain of Hsp40 chaperones. It was shown that this region functions as a bona fide J-domain as it can replace the J-domain of Escherichia coli DnaJ-protein. Mdg1 is also upregulated in primary endothelial and mesangial cells when subjected to various stress stimuli. GFP -Mdg1 fusion constructs showed the Mdg1-protein to be localized within the cytoplasm under control conditions. Stress induces the translocation of Mdg1 into the nucleus, where it accumulates in nucleoli. Costaining with Hdj1, Hdj2, Hsp70, and Hsc70 revealed that Mdg1 colocalizes with Hsp70 and Hdj1 in control and stressed HeLa cells. These data suggest that Mdg1 is involved in the control of cell cycle arrest taking place during terminal cell differentiation and under stress conditions.
Product Categories/Family for Mdg-1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,518 Da
NCBI Official Full Name
dnaJ homolog subfamily B member 9
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily B, member 9
NCBI Official Symbol
DNAJB9
NCBI Official Synonym Symbols
MDG1; ERdj4; MDG-1; MST049; MSTP049
NCBI Protein Information
dnaJ homolog subfamily B member 9; ER-resident protein ERdj4; endoplasmic reticulum DnaJ homolog 4; endoplasmic reticulum DNA J domain-containing protein 4; microvascular endothelial differentiation gene 1 protein
UniProt Protein Name
DnaJ homolog subfamily B member 9
UniProt Gene Name
DNAJB9
UniProt Synonym Gene Names
MDG1; ER-resident protein ERdj4; ERdj4; Mdg-1
UniProt Entry Name
DNJB9_HUMAN
NCBI Description
This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]
Uniprot Description
DNAJB9: Acts as a co-chaperone with an Hsp70 protein.
Protein type: Endoplasmic reticulum; Chaperone
Chromosomal Location of Human Ortholog: 7q31|14q24.2-q24.3
Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum lumen; endoplasmic reticulum; cytoplasm; nucleolus
Molecular Function: protein binding; misfolded protein binding
Biological Process: ER-associated protein catabolic process; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; unfolded protein response
Research Articles on Mdg-1
Similar Products
Product Notes
The Mdg-1 dnajb9 (Catalog #AAA692232) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human Mdg-1 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Protein Sequence: MKHHHHHHSA GLEVLFQGPM ASKSYYDTLG VPKSASERQI KKAFHKLAMK YHPDKNKSPD AEAKFREIAE AYETLSDANR RKEYDTLGHS AFTSGKGQRG SGSSFEQSFN FNFDDLFKDF GFFGQNQNTG SKKRFENHFQ TRQDGGSSRQ RHHFQEFSFG GGLFDDMFED MEKMFSFSGF DSTNQHTVQT ENRFHGSSKH CRTVTQRRGN MVTTYTDCSG Q. It is sometimes possible for the material contained within the vial of "Mdg-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
