Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DnaJ homolog subfamily B member 9 (DNAJB9) Recombinant Protein | DNAJB9 recombinant protein

Recombinant Human DnaJ homolog subfamily B member 9 (DNAJB9)

Gene Names
DNAJB9; MDG1; ERdj4; MDG-1; MST049; MSTP049
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily B member 9 (DNAJB9); Recombinant Human DnaJ homolog subfamily B member 9 (DNAJB9); DNAJB9 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-223, Full length protein
Sequence
SKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Sequence Length
200
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,518 Da
NCBI Official Full Name
dnaJ homolog subfamily B member 9
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member B9
NCBI Official Symbol
DNAJB9
NCBI Official Synonym Symbols
MDG1; ERdj4; MDG-1; MST049; MSTP049
NCBI Protein Information
dnaJ homolog subfamily B member 9
UniProt Protein Name
DnaJ homolog subfamily B member 9
Protein Family
UniProt Gene Name
DNAJB9
UniProt Synonym Gene Names
; Mdg-1

NCBI Description

This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]

Uniprot Description

Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR) (). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required for efficient substrate recognition by Hsp70 proteins (PubMed:18400946). In the unstressed endoplasmic reticulum, interacts with the luminal region of ERN1/IRE1 and selectively recruits HSPA5/BiP: HSPA5/BiP disrupts the dimerization of the active ERN1/IRE1 luminal region, thereby inactivating ERN1/IRE1 (). Also involved in endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins. Required for survival of B-cell progenitors and normal antibody production ().

Research Articles on DNAJB9

Similar Products

Product Notes

The DNAJB9 dnajb9 (Catalog #AAA1353858) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-223, Full length protein. The amino acid sequence is listed below: SKSYYDILGV PKSASERQIK KAFHKLAMKY HPDKNKSPDA EAKFREIAEA YETLSDANRR KEYDTLGHSA FTSGKGQRGS GSSFEQSFNF NFDDLFKDFG FFGQNQNTGS KKRFENHFQT RQDGGSSRQR HHFQEFSFGG GLFDDMFEDM EKMFSFSGFD STNQHTVQTE NRFHGSSKHC RTVTQRRGNM VTTYTDCSGQ. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily B member 9 (DNAJB9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.