Chaperone protein DnaJ (dnaJ) Recombinant Protein | dnaJ recombinant protein

Recombinant Yersinia pseudotuberculosis serotype O:3 Chaperone protein DnaJ (dnaJ)

Cat. Num. AAA1022567

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Chaperone protein DnaJ (dnaJ); Recombinant Yersinia pseudotuberculosis serotype O:3 Chaperone protein DnaJ (dnaJ); dnaJ recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-379, Full length
• Sequence: MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEEKFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGFGGGGGGADFSDIFGDVFGDIFGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVTCPTCHGAGQVQMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLSGEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQKQLLRELEESFVGAAGEKNSPRAKSFLDGVKKFFDDLTR
• Sequence Length: 379

• Species: Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 488138041
• NCBI Accession #: WP_002209249.1
• NCBI GenBank Nucleotide #: WP_002209249.1
• UniProt Accession #: B1JL03
• Molecular Weight: 41,279 Da
• NCBI Official Full Name: MULTISPECIES: molecular chaperone DnaJ
• UniProt Protein Name: Chaperone protein DnaJ
• Protein Family: Chaperone protein
• UniProt Gene Name: dnaJ

Uniprot Description

Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.