DnaJ homolog subfamily B member 1 protein Recombinant Protein | DNAJB1 recombinant protein
Recombinant human DnaJ homolog subfamily B member 1 protein
Gene Names
DNAJB1; Hdj1; Sis1; HSPF1; Hsp40; RSPH16B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily B member 1 protein; Recombinant human DnaJ homolog subfamily B member 1 protein; DNAJB1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-340. Full length.
Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Sequence Length
340
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
Related Product Information for DNAJB1 recombinant protein
Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
References
[1] "A human homologue of the Escherichia coli DnaJ heat-shock protein."
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
39 KD
NCBI Official Full Name
dnaJ homolog subfamily B member 1 isoform 1
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily B, member 1
NCBI Official Symbol
DNAJB1
NCBI Official Synonym Symbols
Hdj1; Sis1; HSPF1; Hsp40; RSPH16B
NCBI Protein Information
dnaJ homolog subfamily B member 1
Protein Family
Research Articles on DNAJB1
Similar Products
Product Notes
The DNAJB1 (Catalog #AAA956547) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-340. Full length. The amino acid sequence is listed below: MGKDYYQTLG LARGASDEEI KRAYRRQALR YHPDKNKEPG AEEKFKEIAE AYDVLSDPRK REIFDRYGEE GLKGSGPSGG SGGGANGTSF SYTFHGDPHA MFAEFFGGRN PFDTFFGQRN GEEGMDIDDP FSGFPMGMGG FTNVNFGRSR SAQEPARKKQ DPPVTHDLRV SLEEIYSGCT KKMKISHKRL NPDGKSIRNE DKILTIEVKK GWKEGTKITF PKEGDQTSNN IPADIVFVLK DKPHNIFKRD GSDVIYPARI SLREALCGCT VNVPTLDGRT IPVVFKDVIR PGMRRKVPGE GLPLPKTPEK RGDLIIEFEV IFPERIPQTS RTVLEQVLPI . It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily B member 1 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
