Dihydrolipoyl dehydrogenase, mitochondrial (DLD) Recombinant Protein | DLD recombinant protein
Recombinant Mesocricetus auratus Dihydrolipoyl dehydrogenase, mitochondrial (DLD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dihydrolipoyl dehydrogenase; mitochondrial (DLD); Recombinant Mesocricetus auratus Dihydrolipoyl dehydrogenase; DLD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-479, full length protein
Sequence
ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHLAHGKDFASRGIELSEVRLNLEKMMEQKSSAVKALTGGIAHLFKQNKVVHVNGFGNITGKNQVTATKADGSSQVIGTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGAEVTAVEFLGHVGGIGIDMEISKKFQRILQKQGFKFKLNPKVPGATKRSDGKIDVSVEAAPGGKAEVIPCDVLLVCIGRRPFTQNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFR
Sequence Length
460
Species
Mesocricetus auratus (Golden hamster)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
50,723 Da
NCBI Official Full Name
Dihydrolipoyl dehydrogenase, mitochondrial
UniProt Protein Name
Dihydrolipoyl dehydrogenase, mitochondrial
Protein Family
UniProt Gene Name
DLD
Uniprot Description
Lipoamide dehydrogenase is a component of the glycine cleavage system as well as an E3 component of three alpha-ketoacid dehydrogenase complexes (pyruvate-, alpha-ketoglutarate-, and branched-chain amino acid-dehydrogenase complex) (PubMed:15888450). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion (). A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A (). In monomeric form may have additional moonlighting function as serine protease (). Involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction (PubMed:14645106, PubMed:15888450).
Similar Products
Product Notes
The DLD dld (Catalog #AAA1309392) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-479, full length protein. The amino acid sequence is listed below: ADQPIDADVT VIGSGPGGYV AAIKAAQLGF KTVCIEKNET LGGTCLNVGC IPSKALLNNS HYYHLAHGKD FASRGIELSE VRLNLEKMME QKSSAVKALT GGIAHLFKQN KVVHVNGFGN ITGKNQVTAT KADGSSQVIG TKNILIATGS EVTPFPGITI DEDTIVSSTG ALSLKKVPEK LVVIGAGVIG VELGSVWQRL GAEVTAVEFL GHVGGIGIDM EISKKFQRIL QKQGFKFKLN PKVPGATKRS DGKIDVSVEA APGGKAEVIP CDVLLVCIGR RPFTQNLGLE ELGIELDPRG RIPVNTRFQT KIPNIYAIGD VVAGPMLAHK AEDEGIICVE GMAGGAVHID YNCVPSVIYT HPEVAWVGKS EEQLKEEGIE YKVGKFPFAA NSRAKTNADT DGMVKILGQK STDRVLGAHI LGPGAGEMVN EAALALEYGA SCEDIARVCH AHPTLSEAFR. It is sometimes possible for the material contained within the vial of "Dihydrolipoyl dehydrogenase, mitochondrial (DLD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
