Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Dickkopf-related protein 1 Recombinant Protein | DKK1 recombinant protein

Recombinant human Dickkopf-related protein 1 protein

Gene Names
DKK1; SK; DKK-1
Applications
ELISA, Western Blot
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dickkopf-related protein 1; Recombinant human Dickkopf-related protein 1 protein; DKK1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Applicable Applications for DKK1 recombinant protein
ELISA (EIA), Western Blot (WB)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for DKK1 recombinant protein
DKK1 is an inhibitor of the Wnt signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 KD
NCBI Official Full Name
Homo sapiens dickkopf 1 homolog (Xenopus laevis) (DKK1), mRNA
NCBI Official Synonym Full Names
dickkopf 1 homolog (Xenopus laevis)
NCBI Official Symbol
DKK1
NCBI Official Synonym Symbols
SK; DKK-1
NCBI Protein Information
dickkopf-related protein 1; hDkk-1; dickkopf-1 like; dickkopf-like protein 1; dickkopf related protein-1
UniProt Protein Name
Dickkopf-related protein 1
Protein Family
UniProt Gene Name
DKK1
UniProt Synonym Gene Names
Dickkopf-1; Dkk-1; hDkk-1
UniProt Entry Name
DKK1_HUMAN

NCBI Description

This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Ref.15

Subunit structure: Interacts with LRP6. Interacts (via the C-termianl Cys-rich domain) with LRP5 (via beta-propeller regions 3 and 4); the interaction, enhanced by MESD and or KREMEN, antagonizes Wnt-mediated signaling. Ref.10 Ref.12 Ref.13

Subcellular location: Secreted.

Tissue specificity: Placenta.

Domain: The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6

By similarity.

Sequence similarities: Belongs to the dickkopf family.

Research Articles on DKK1

Similar Products

Product Notes

The DKK1 dkk1 (Catalog #AAA717122) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Dickkopf-related protein 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Researchers should empirically determine the suitability of the DKK1 dkk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLNSVLNSNA IKNLPPPLGG AAGHPGSAVS AAPGILYPGG NKYQTIDNYQ PYPCAEDEEC GTDEYCASPT RGGDAGVQIC LACRKRRKRC MRHAMCCPGN YCKNGICVSS DQNHFRGEIE ETITESFGND HSTLDGYSRR TTLSSKMYHT KGQEGSVCLR SSDCASGLCC ARHFWSKICK PVLKEGQVCT KHRRKGSHGL EIFQRCYCGE GLSCRIQKDH HQASNSSRLH TCQRH. It is sometimes possible for the material contained within the vial of "Dickkopf-related protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.