DOA4-independent degradation protein 4 (DID4) Recombinant Protein | DID4 recombinant protein
Recombinant Saccharomyces cerevisiae DOA4-independent degradation protein 4 (DID4)
Gene Names
DID4; CHM2; GRD7; REN1; VPL2; VPS14; VPS2; VPT14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DOA4-independent degradation protein 4 (DID4); Recombinant Saccharomyces cerevisiae DOA4-independent degradation protein 4 (DID4); DID4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-232, full length protein
Sequence
MSLFEWVFGKNVTPQERLKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAKDLVRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEFEKQSDLMGQRQEFMDEAIDNVMGDEVDEDEEADEIVNKVLDEIGVDLNSQLQSTPQNLVSNAPIAETAMGIPEPIGAGSEFHGNPDDDLQARLNTLKKQT
Sequence Length
232
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,291 Da
NCBI Official Full Name
ESCRT-III subunit protein DID4
NCBI Official Symbol
DID4
NCBI Official Synonym Symbols
CHM2; GRD7; REN1; VPL2; VPS14; VPS2; VPT14
NCBI Protein Information
ESCRT-III subunit protein DID4
UniProt Protein Name
DOA4-independent degradation protein 4
Protein Family
UniProt Gene Name
DID4
UniProt Synonym Gene Names
CHM2; GRD7; REN1; VPL2; VPS2; VPT14
Uniprot Description
Required for the sorting and concentration of proteins resulting in the entry of these proteins into the invaginating vesicles of the multivesicular body (MVB). Acts a component of the ESCRT-III complex, which appears to be critical for late steps in MVB sorting, such as membrane invagination and final cargo sorting and recruitment of late-acting components of the sorting machinery. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complex assemblies. Can directly stimulate VPS4 ATPase activity. The DID4/VPS2-VPS24 subcomplex is required for the VPS4-dependent dissociation of ESCRT-III.
Research Articles on DID4
Similar Products
Product Notes
The DID4 did4 (Catalog #AAA1100693) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-232, full length protein. The amino acid sequence is listed below: MSLFEWVFGK NVTPQERLKK NQRALERTQR ELEREKRKLE LQDKKLVSEI KKSAKNGQVA AAKVQAKDLV RTRNYIQKFD NMKAQLQAIS LRIQAVRSSD QMTRSMSEAT GLLAGMNRTM NLPQLQRISM EFEKQSDLMG QRQEFMDEAI DNVMGDEVDE DEEADEIVNK VLDEIGVDLN SQLQSTPQNL VSNAPIAETA MGIPEPIGAG SEFHGNPDDD LQARLNTLKK QT. It is sometimes possible for the material contained within the vial of "DOA4-independent degradation protein 4 (DID4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
