Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Derlin-1 (DER1) Recombinant Protein | DER1 recombinant protein

Recombinant Oryza sativa subsp. japonica Derlin-1 (DER1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Derlin-1 (DER1); Recombinant Oryza sativa subsp. japonica Derlin-1 (DER1); Recombinant Derlin-1 (DER1); Derlin-1; 18 kDa cold-induced protein DER1-like protein 1 OsDerlin 1-1; DER1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-242
Sequence
MSSPAEYYNSLPPISKAYGTLCFFATVLCQLQILNPPFLALYYPFVFKKFQIWRLFTSFFFLGKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDIYFLGVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGILVGHTYYFLSVLHPLATGKNYLKTPMWVHKIVARFRIGVQANAPVRPAAANTGSGAFRGRSYRLSQ
Sequence Length
242
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
27,532 Da
NCBI Official Full Name
Derlin-1
UniProt Protein Name
Derlin-1
Protein Family
UniProt Gene Name
DER1
UniProt Entry Name
DERL1_ORYSJ

Uniprot Description

Function: May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Seedling shoots and roots.

Sequence similarities: Belongs to the derlin family.

Sequence caution: The sequence AAS86403.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAV31196.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAA01631.1 differs from that shown. Reason: Frameshift at several positions. The sequence BAA01631.1 differs from that shown. Reason: Sequencing errors.

Similar Products

Product Notes

The Derlin-1 (DER1) der1 (Catalog #AAA1067394) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-242. The amino acid sequence is listed below: MSSPAEYYNS LPPISKAYGT LCFFATVLCQ LQILNPPFLA LYYPFVFKKF QIWRLFTSFF FLGKFSINFG IRLLMIARYG VQLEKGAFEK RTADFLWMMI FGAISLLALS AIPFLDIYFL GVPMVSMLLY VWSREYPNSQ ISMYGLVQLR SFYLPWAMLG LDVIFGSEIL PGLLGILVGH TYYFLSVLHP LATGKNYLKT PMWVHKIVAR FRIGVQANAP VRPAAANTGS GAFRGRSYRL SQ. It is sometimes possible for the material contained within the vial of "Derlin-1 (DER1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.