SDS-PAGE
Beta-defensin 4 Recombinant Protein | Defb4 recombinant protein
Recombinant Mouse Beta-defensin 4
Gene Names
Defb4; BD-4; 2310001F05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-defensin 4; Recombinant Mouse Beta-defensin 4; Defensin; beta 4; Defb4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-63aa; Full Length of Mature Protein
Sequence
QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR
Sequence Length
63
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Defb4 recombinant protein
Has bactericidal activity
References
"A novel murine beta-defensin expressed in tongue, esophagus, and trachea." Jia H.P., Wowk S.A., Schutte B.C., Lee S.K., Vivado A., Tack B.F., Bevins C.L., McCray P.B. Jr. J. Biol. Chem. 275:33314-33320(2000)
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
20.6 kDa
NCBI Official Synonym Full Names
defensin beta 4
NCBI Official Symbol
Defb4
NCBI Official Synonym Symbols
BD-4; 2310001F05Rik
NCBI Protein Information
beta-defensin 4
UniProt Protein Name
Beta-defensin 4
Protein Family
UniProt Gene Name
Defb4
UniProt Synonym Gene Names
Bdef4; BD-4; mBD-4
UniProt Entry Name
DEFB4_MOUSE
Uniprot Description
Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells (PubMed:20068036).
Research Articles on Defb4
Similar Products
Product Notes
The Defb4 defb4 (Catalog #AAA1165917) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-63aa; Full Length of Mature Protein. The amino acid sequence is listed below: QIINNPITCM TNGAICWGPC PTAFRQIGNC GHFKVRCCKI R. It is sometimes possible for the material contained within the vial of "Beta-defensin 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
