Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Beta-defensin 1 Recombinant Protein | DEFB1 recombinant protein

Recombinant Human Beta-defensin 1

Gene Names
DEFB1; BD1; HBD1; DEFB-1; DEFB101
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-defensin 1; Recombinant Human Beta-defensin 1; Defensin; beta 1; DEFB1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
33-68
Sequence
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Sequence Length
68
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for DEFB1 recombinant protein
Has bactericidal activity.
Product Categories/Family for DEFB1 recombinant protein
References
The human beta-defensin-1 and alpha-defensins are encoded by adjacent genes two peptide families with differing disulfide topology share a common ancestry.Liu L., Zhao C., Heng H.H.Q., Ganz T.Genomics 43:316-320(1997) Zhao C. Human airway epithelia express a beta-defensin.McCray P.B. Jr., Bentley L.Am. J. Respir. Cell Mol. Biol. 16:343-349(1997) hBD-1 a novel beta-defensin from human plasma.Bensch K.W., Raida M., Maegert H.-J., Schulz-Knappe P., Forssmann W.-G.FEBS Lett. 368:331-335(1995) Chemical synthesis of beta-defensins and LEAP-1/hepcidin.Kluever E., Schulz A., Forssmann W.-G., Adermann K.J. Pept. Res. 59:241-248(2002) The structure of human beta-defensin-1 new insights into structural properties of beta-defensins.Hoover D.M., Chertov O., Lubkowski J.J. Biol. Chem. 276:39021-39026(2001) Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity.Bauer F., Schweimer K., Kluever E., Conejo-Garcia J.-R., Forssmann W.-G., Roesch P., Adermann K., Sticht H.Protein Sci. 10:2470-2479(2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kD
NCBI Official Full Name
beta-defensin 1 preproprotein
NCBI Official Synonym Full Names
defensin beta 1
NCBI Official Symbol
DEFB1
NCBI Official Synonym Symbols
BD1; HBD1; DEFB-1; DEFB101
NCBI Protein Information
beta-defensin 1
UniProt Protein Name
Beta-defensin 1
Protein Family
UniProt Gene Name
DEFB1
UniProt Synonym Gene Names
BD1; HBD1; BD-1; hBD-1
UniProt Entry Name
DEFB1_HUMAN

NCBI Description

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]

Uniprot Description

defensin, beta 1: Has bactericidal activity. Belongs to the beta-defensin family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: extracellular region; extracellular space; Golgi lumen

Biological Process: acute inflammatory response; antibacterial humoral response; chemotaxis; defense response to Gram-positive bacterium; G-protein coupled receptor protein signaling pathway; immune response; innate immune response; innate immune response in mucosa; response to bacterium; response to testosterone stimulus

Research Articles on DEFB1

Similar Products

Product Notes

The DEFB1 defb1 (Catalog #AAA1265483) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-68. The amino acid sequence is listed below: DHYNCVSSGG QCLYSACPIF TKIQGTCYRG KAKCCK. It is sometimes possible for the material contained within the vial of "Beta-defensin 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.