Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Spliceosome RNA helicase DDX39B (DDX39B) Recombinant Protein | DDX39B recombinant protein

Recombinant Pan troglodytes Spliceosome RNA helicase DDX39B (DDX39B)

Gene Names
DDX39B; BAT1; UAP56
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spliceosome RNA helicase DDX39B (DDX39B); Recombinant Pan troglodytes Spliceosome RNA helicase DDX39B (DDX39B); DDX39B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-428, Full length protein
Sequence
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Sequence Length
427
Species
Pan troglodytes (Chimpanzee)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,991 Da
NCBI Official Full Name
spliceosome RNA helicase DDX39B
NCBI Official Synonym Full Names
DExD-box helicase 39B
NCBI Official Symbol
DDX39B
NCBI Official Synonym Symbols
BAT1; UAP56
NCBI Protein Information
spliceosome RNA helicase DDX39B
UniProt Protein Name
Spliceosome RNA helicase DDX39B
Protein Family
UniProt Gene Name
DDX39B
UniProt Synonym Gene Names
BAT1; UAP56

Uniprot Description

Involved in nuclear export of spliced and unspliced mRNA. Assembling component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. Also associates with pre-mRNA independent of ALYREF/THOC4 and the THO complex. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability ().

Similar Products

Product Notes

The DDX39B ddx39b (Catalog #AAA1016040) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-428, Full length protein. The amino acid sequence is listed below: AENDVDNELL DYEDDEVETA AGGDGAEAPA KKDVKGSYVS IHSSGFRDFL LKPELLRAIV DCGFEHPSEV QHECIPQAIL GMDVLCQAKS GMGKTAVFVL ATLQQLEPVT GQVSVLVMCH TRELAFQISK EYERFSKYMP NVKVAVFFGG LSIKKDEEVL KKNCPHIVVG TPGRILALAR NKSLNLKHIK HFILDECDKM LEQLDMRRDV QEIFRMTPHE KQVMMFSATL SKEIRPVCRK FMQDPMEIFV DDETKLTLHG LQQYYVKLKD NEKNRKLFDL LDVLEFNQVV IFVKSVQRCI ALAQLLVEQN FPAIAIHRGM PQEERLSRYQ QFKDFQRRIL VATNLFGRGM DIERVNIAFN YDMPEDSDTY LHRVARAGRF GTKGLAITFV SDENDAKILN DVQDRFEVNI SELPDEIDIS SYIEQTR. It is sometimes possible for the material contained within the vial of "Spliceosome RNA helicase DDX39B (DDX39B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.