D-dopachrome decarboxylase (DDT) Recombinant Protein | DDT recombinant protein
Recombinant Human D-dopachrome decarboxylase (DDT)
Gene Names
DDT; D-DT; DDCT; MIF2; MIF-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
D-dopachrome decarboxylase (DDT); Recombinant Human D-dopachrome decarboxylase (DDT); DDT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-118, Full length protein
Sequence
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Sequence Length
117
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DDT recombinant protein
D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
11,323 Da
NCBI Official Full Name
D-dopachrome decarboxylase
NCBI Official Synonym Full Names
D-dopachrome tautomerase
NCBI Official Symbol
DDT
NCBI Official Synonym Symbols
D-DT; DDCT; MIF2; MIF-2
NCBI Protein Information
D-dopachrome decarboxylase
UniProt Protein Name
D-dopachrome decarboxylase
Protein Family
UniProt Gene Name
DDT
NCBI Description
D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]
Uniprot Description
Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Research Articles on DDT
Similar Products
Product Notes
The DDT ddt (Catalog #AAA952284) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-118, Full length protein. The amino acid sequence is listed below: PFLELDTNLP ANRVPAGLEK RLCAAAASIL GKPADRVNVT VRPGLAMALS GSTEPCAQLS ISSIGVVGTA EDNRSHSAHF FEFLTKELAL GQDRILIRFF PLESWQIGKI GTVMTFL. It is sometimes possible for the material contained within the vial of "D-dopachrome decarboxylase (DDT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
