Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Recombinant Protein | Ddost recombinant protein

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; Ddost recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-441aa; full length protein
Sequence
GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Ddost recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Ddost recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,028 Da
NCBI Official Full Name
dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
NCBI Official Synonym Full Names
dolichyl-di-phosphooligosaccharide-protein glycotransferase
NCBI Official Symbol
Ddost
NCBI Protein Information
dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
UniProt Gene Name
Ddost
UniProt Synonym Gene Names
DDOST 48 kDa subunit; Oligosaccharyl transferase 48 kDa subunit
UniProt Entry Name
OST48_MOUSE

Uniprot Description

DDOST: Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Defects in DDOST are the cause of congenital disorder of glycosylation type 1R (CDG1R). A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Belongs to the DDOST 48 kDa subunit family.

Protein type: EC 2.4.99.18; Transferase; Membrane protein, integral; Glycan Metabolism - N-glycan biosynthesis; Endoplasmic reticulum

Cellular Component: endoplasmic reticulum; intracellular membrane-bound organelle; membrane; protein complex

Molecular Function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity

Biological Process: protein amino acid N-linked glycosylation; response to cytokine stimulus; T cell activation

Research Articles on Ddost

Similar Products

Product Notes

The Ddost ddost (Catalog #AAA7042612) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-441aa; full length protein. The amino acid sequence is listed below: GPRTLVLLDN LNVRDTHSLF FRSLKDRGFE LTFKTADDPS LSLIKYGEFL YDNLIIFSPS VEDFGGNINV ETISAFIDGG GSVLVAASSD IGDPLRELGS ECGIEFDEEK TAVIDHHNYD VSDLGQHTLI VADTENLLKA PTIVGKSSLN PILFRGVGMV ADPDNPLVLD ILTGSSTSYS FFPDKPITQY PHAVGRNTLL IAGLQARNNA RVIFSGSLDF FSDAFFNSAV QKATPGAQRY SQTGNYELAV ALSRWVFKEE GVLRVGPVSH HRVGEMAPPN AYTVTDLVEY SIIIEQLSNG KWVPFDGDDI QLEFVRIDPF VRTFLKRKGG KYSVQFKLPD VYGVFQFKVD YNRLGYTHLY SSTQVSVRPL QHTQYERFIP SAYPYYASAF SMMAGLFIFS IVFLHMKEKE KSD. It is sometimes possible for the material contained within the vial of "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.