Diazepam Binding Inhibitor (DBI) Recombinant Protein | DBI recombinant protein

Recombinant Diazepam Binding Inhibitor (DBI)

Cat. Num. AAA2010421

• Gene Names: DBI; EP; ACBP; ACBD1; CCK-RP
• Applications: SDS-Page, Western Blot, ELISA, Immunoprecipitation
• Purity: > 95%
• Synonyms: Diazepam Binding Inhibitor (DBI); Recombinant Diazepam Binding Inhibitor (DBI); DBI recombinant protein

• Host: E Coli
• Purity/Purification: > 95%
• Form/Format: Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
• Sequence: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.; MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI
• Sequence Length: 87

• Applicable Applications for DBI recombinant protein: SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
• Organism: Homo sapiens (Human)
• Expression System: Prokaryotic expression
• Residues: Met1~Ile87 (Accession # P07108) with two N-terminal Tags, His-tag and S-tag
• Endotoxin Level: <1.0EU per 1ug (determined by the LAL method)
• Reconstitution: Reconstitute in sterile PBS, pH7.2-pH7.4.
• Preparation and Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.; Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

NCBI and Uniprot Product Information

• NCBI GI #: 120433590
• NCBI GeneID: 1622
• NCBI Accession #: NP_001073331.1
• NCBI GenBank Nucleotide #: NM_001079862.2
• UniProt Accession #: P07108; P08869; Q4VWZ6; Q53SQ7; Q6IB48; Q9UCI8; B8ZWD2; B8ZWD6; B8ZWD7
• Molecular Weight: 15.8kDa
• NCBI Official Full Name: acyl-CoA-binding protein isoform 3
• NCBI Official Synonym Full Names: diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
• NCBI Official Symbol: DBI
• NCBI Official Synonym Symbols: EP; ACBP; ACBD1; CCK-RP
• NCBI Protein Information: acyl-CoA-binding protein; endozepine; GABA receptor modulator; diazepam-binding inhibitor; acyl coenzyme A binding protein; acyl-Coenzyme A binding domain containing 1; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
• UniProt Protein Name: Acyl-CoA-binding protein
• Protein Family: Acyl-CoA-binding protein
• UniProt Gene Name: DBI
• UniProt Synonym Gene Names: ACBP; DBI; EP
• UniProt Entry Name: ACBP_HUMAN

NCBI Description

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DBI: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Belongs to the ACBP family. 6 isoforms of the human protein are produced by alternative promoter.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: Golgi apparatus; mitochondrion; endoplasmic reticulum

Molecular Function: protein dimerization activity; benzodiazepine receptor binding; lipid binding

Biological Process: behavioral fear response; protein palmitoylation; learning and/or memory; triacylglycerol metabolic process; hair follicle development; transport; lateral ventricle development