Death-associated protein 1 Recombinant Protein | DAP1 recombinant protein

Recombinant Human Death-associated protein 1

Cat. Num. AAA717242

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Death-associated protein 1; Recombinant Human Death-associated protein 1; DAP1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-102aa; Full Length
• Sequence: SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
• Sequence Length: 102

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DAP1 recombinant protein

Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death.

Product Categories/Family for DAP1 recombinant protein

Apoptosis

References

Identification of a novel serine/threonine kinase and a novel 15-kD protein as potential mediators of the gamma interferon-induced cell death.Deiss L.P., Feinstein E., Berissi H., Cohen O., Kimchi A.Genes Dev. 9:15-30(1995) Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) DAP1, a novel substrate of mTOR, negatively regulates autophagy.Koren I., Reem E., Kimchi A.Curr. Biol. 20:1093-1098(2010) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011)

NCBI and Uniprot Product Information

• NCBI GeneID: 1611
• UniProt Accession #: P51397; Q6FGC3; Q9BUC9
• Molecular Weight: 38 kDa
• NCBI Official Synonym Full Names: death-associated protein
• NCBI Official Symbol: DAP
• NCBI Protein Information: death-associated protein 1
• UniProt Protein Name: Death-associated protein 1
• Protein Family: Damage response protein
• UniProt Gene Name: DAP
• UniProt Synonym Gene Names: DAP1; DAP-1
• UniProt Entry Name: DAP1_HUMAN

NCBI Description

This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

Uniprot Description

DAP: a 15 kDa, proline rich protein that possesses one SH3 binding motif. Negatively regulates autophagy and is involved in mediating interferon-gamma-induced cell death. Localizes in the cytoplasm, but the detailed mechanism of its proapoptotic function is unclear.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 5p15.2

Biological Process: apoptosis; autophagy; caspase activation; cellular response to amino acid starvation; inhibition of NF-kappaB transcription factor; negative regulation of autophagy; negative regulation of transcription, DNA-dependent