Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cysteinyl leukotriene receptor 2 (Cysltr2) Recombinant Protein | Cysltr2 recombinant protein

Recombinant Rat Cysteinyl leukotriene receptor 2 (Cysltr2)

Gene Names
Cysltr2; Cyslt2; RSBPT32
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteinyl leukotriene receptor 2 (Cysltr2); Recombinant Rat Cysteinyl leukotriene receptor 2 (Cysltr2); Cysltr2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-309aa; full length protein
Sequence
MGVTGTPSYYSDKNCTIENFKRDFYPIIYLIIFVWGALGNGFSIYVFLQTYKKSTSVNVF MLNLAISDFLFISTLPFRADYNFRGSDWIFGDWACRIMSYSLYVNMYTSIYFLTVLSIVR FLATAHPFQMLHITSVRSAWILCGIIWVFIMASSGLLLKHGQEKKNNTTLCFELNLQKFK NLVILNYIALGVGFLLPFFILTICYLLIIRVLLKVEIPESGPRDAQRKALTTIVIAMIIF LLCFLPYHALRTIHLVTWDADSCMDELHKATVITLTLAAANSCFNPFLYYFAGENFKARL RAIFSKDHL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cysltr2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,507 Da
NCBI Official Full Name
cysteinyl leukotriene receptor 2
NCBI Official Synonym Full Names
cysteinyl leukotriene receptor 2
NCBI Official Symbol
Cysltr2
NCBI Official Synonym Symbols
Cyslt2; RSBPT32
NCBI Protein Information
cysteinyl leukotriene receptor 2
UniProt Protein Name
Cysteinyl leukotriene receptor 2
UniProt Gene Name
Cysltr2
UniProt Synonym Gene Names
Cyslt2; CysLTR2
UniProt Entry Name
CLTR2_RAT

NCBI Description

putative cysteinyl leukotriene receptor [RGD, Feb 2006]

Uniprot Description

CYSLTR2: Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol- calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins and might also have an indirect role in the relaxation of the pulmonary vascular endothelium. The rank order of affinities for the leukotrienes is LTC4 = LTD4 >> LTE4. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral; GPCR, family 1

Cellular Component: integral to plasma membrane; membrane

Molecular Function: cysteinyl leukotriene receptor activity; peptide receptor activity, G-protein coupled

Biological Process: G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); neuropeptide signaling pathway; positive regulation of angiogenesis

Research Articles on Cysltr2

Similar Products

Product Notes

The Cysltr2 cysltr2 (Catalog #AAA7013524) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-309aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cysltr2 cysltr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGVTGTPSYY SDKNCTIENF KRDFYPIIYL IIFVWGALGN GFSIYVFLQT YKKSTSVNVF MLNLAISDFL FISTLPFRAD YNFRGSDWIF GDWACRIMSY SLYVNMYTSI YFLTVLSIVR FLATAHPFQM LHITSVRSAW ILCGIIWVFI MASSGLLLKH GQEKKNNTTL CFELNLQKFK NLVILNYIAL GVGFLLPFFI LTICYLLIIR VLLKVEIPES GPRDAQRKAL TTIVIAMIIF LLCFLPYHAL RTIHLVTWDA DSCMDELHKA TVITLTLAAA NSCFNPFLYY FAGENFKARL RAIFSKDHL. It is sometimes possible for the material contained within the vial of "Cysteinyl leukotriene receptor 2 (Cysltr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.