Modulator of retrovirus infection (MRI) Recombinant Protein | MRI recombinant protein

Recombinant Cricetulus griseus Modulator of retrovirus infection (MRI)

Cat. Num. AAA1311883

• Gene Names: Cyren; Mri
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Modulator of retrovirus infection (MRI); Recombinant Cricetulus griseus Modulator of retrovirus infection (MRI); MRI recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-154, full length protein
• Sequence: METLKSENKKRVLPSWMTAPVDEKRELSVKTPKRKKIAAGQVGLATRAPVMKTVYCMNEAEMVDVALGILIEGRKQEEPTLVAPDKPQPSPPYSASPHTSSPGSSSEKEDSGNRWPALGLSPSHGPEAADSPCSRSPEEEEEDALKYVREIFFS
• Sequence Length: 154

• Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 350538501
• NCBI GeneID: 100689364
• NCBI Accession #: NP_001233721.1
• NCBI GenBank Nucleotide #: NM_001246792.1
• UniProt Accession #: Q09HN1
• Molecular Weight: 16,850 Da
• NCBI Official Full Name: cell cycle regulator of non-homologous end joining
• NCBI Official Symbol: Cyren
• NCBI Official Synonym Symbols: Mri
• NCBI Protein Information: cell cycle regulator of non-homologous end joining
• UniProt Protein Name: Cell cycle regulator of non-homologous end joining
• Protein Family: Modulator of retrovirus infection
• UniProt Gene Name: CYREN
• UniProt Synonym Gene Names: Cell cycle regulator of NHEJ

Uniprot Description

Cell-cycle-specific inhibitor of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair during the S and G2 phases. Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present. Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination. Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70, interaction restricted during the S and G2 phases only. Molecular mechanisms governing classical NHEJ inhibition via interaction with XRCC5/Ku80 and XRCC6/Ku70 are unknown (). May act as a regulator of proteasome (PubMed:17043244). In case of infection by a retrovirus, may regulate the proteasome during the uncoating phase of retrovirus (PubMed:17043244).