7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase Recombinant Protein | Cyp8b1 recombinant protein
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase; Cyp8b1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-500aa; full length protein
Sequence
TLWCTVLGALLTVVGCLCLSLLLRHRRPWEPPLDKGFVPWLGHSMAFRKNMFEFLKGMRAKHGDVFTVQLGGQYFTFVMDPLSFGPIIKNTEKALDFQSYAKELVLKVFGYQSVDGDHRMIHLASTKHLMGQGLEELNQAMLDSLSLVMLGPKGSSLGASSWCEDGLFHFCYRILFKAGFLSLFGYTKDKQQDLDEADELFRKFRRFDFLFPRFVYSLLGPREWVEVSQLQRLFHQRLSVEQNLEKDGISCWLGYMLQFLREQGIASSMQDKFNFMMLWASQGNTGPTCFWVLLFLLKHQDAMKAVREEATRVMGKARLEAKKSFTFTPSALKHTPVLDSVMEESLRLCATPTLLRVVQEDYVLKMASGQEYQIRRGDKVALFPYLSVHMDPDIHPEPTAFKYDRFLNPDGTRKVDFYKSGKKIHHYSMPWGSGVSKCPGRFFALSEMKTFVLLMIMYFDFKLVDPDIPVPPIDPRRWGFGTSQPSHEVRFLYRLKPVQ
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Cyp8b1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Cyp8b1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,706 Da
NCBI Official Full Name
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
NCBI Official Synonym Full Names
cytochrome P450, family 8, subfamily b, polypeptide 1
NCBI Official Symbol
Cyp8b1
NCBI Protein Information
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
UniProt Protein Name
7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
Protein Family
UniProt Gene Name
Cyp8b1
UniProt Synonym Gene Names
Cyp12
UniProt Entry Name
CP8B1_MOUSE
Uniprot Description
CYP8B1: Involved in bile acid synthesis and is responsible for the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7 alpha, 12 alpha-dihydroxy-4-cholesten-3-one. Responsible for the balance between formation of cholic acid and chenodeoxycholic acid. Has a rather broad substrate specificity including a number of 7-alpha- hydroxylated C27 steroids. Belongs to the cytochrome P450 family.
Protein type: Membrane protein, integral; EC 1.14.13.95; Oxidoreductase; Lipid Metabolism - primary bile acid biosynthesis
Molecular Function: sterol 12-alpha-hydroxylase activity
Research Articles on Cyp8b1
Similar Products
Product Notes
The Cyp8b1 cyp8b1 (Catalog #AAA7042601) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-500aa; full length protein. The amino acid sequence is listed below: TLWCTVLGAL LTVVGCLCLS LLLRHRRPWE PPLDKGFVPW LGHSMAFRKN MFEFLKGMRA KHGDVFTVQL GGQYFTFVMD PLSFGPIIKN TEKALDFQSY AKELVLKVFG YQSVDGDHRM IHLASTKHLM GQGLEELNQA MLDSLSLVML GPKGSSLGAS SWCEDGLFHF CYRILFKAGF LSLFGYTKDK QQDLDEADEL FRKFRRFDFL FPRFVYSLLG PREWVEVSQL QRLFHQRLSV EQNLEKDGIS CWLGYMLQFL REQGIASSMQ DKFNFMMLWA SQGNTGPTCF WVLLFLLKHQ DAMKAVREEA TRVMGKARLE AKKSFTFTPS ALKHTPVLDS VMEESLRLCA TPTLLRVVQE DYVLKMASGQ EYQIRRGDKV ALFPYLSVHM DPDIHPEPTA FKYDRFLNPD GTRKVDFYKS GKKIHHYSMP WGSGVSKCPG RFFALSEMKT FVLLMIMYFD FKLVDPDIPV PPIDPRRWGF GTSQPSHEVR FLYRLKPVQ. It is sometimes possible for the material contained within the vial of "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
