SDS-PAGE
Steroid C26-monooxygenase Recombinant Protein | cyp125 recombinant protein
Recombinant Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Steroid C26-monooxygenase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Steroid C26-monooxygenase; Recombinant Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Steroid C26-monooxygenase; Cholest-4-en-3-one 26-monooxygenase; Cytochrome P450 125; Steroid C27-monooxygenase; cyp125 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-433aa; Full Length
Sequence
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
Sequence Length
433
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for cyp125 recombinant protein
Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.
References
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.Cole S.T., Brosch R., Parkhill J., Garnier T., Churcher C.M., Harris D.E., Gordon S.V., Eiglmeier K., Gas S., Barry C.E. III, Tekaia F., Badcock K., Basham D., Brown D., Chillingworth T., Connor R., Davies R.M., Devlin K., Feltwell T., Gentles S., Hamlin N., Holroyd S., Hornsby T., Jagels K., Krogh A., McLean J., Moule S., Murphy L.D., Oliver S., Osborne J., Quail M.A., Rajandream M.A., Rogers J., Rutter S., Seeger K., Skelton S., Squares S., Squares R., Sulston J.E., Taylor K., Whitehead S., Barrell B.G.Nature 393:537-544(1998)
Mycobacterial cytochrome p450 125 (cyp125)
catalyzes the terminal hydroxylation of c27 steroids.Capyk J.K., Kalscheuer R., Stewart G.R., Liu J., Kwon H., Zhao R., Okamoto S., Jacobs W.R. Jr., Eltis L.D., Mohn W.W.J. Biol. Chem. 284:35534-35542(2009)
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.Kelkar D.S., Kumar D., Kumar P., Balakrishnan L., Muthusamy B., Yadav A.K., Shrivastava P., Marimuthu A., Anand S., Sundaram H., Kingsbury R., Harsha H.C., Nair B., Prasad T.S., Chauhan D.S., Katoch K., Katoch V.M., Kumar P., Chaerkady R., Ramachandran S., Dash D., Pandey A.Mol. Cell. Proteomics 10:M111.011627-M111.011627(2011)
The Structure of Mycobacterium tuberculosis CYP125
molecular basis for cholesterol binding in a P450 needed for host infection.McLean K.J., Lafite P., Levy C., Cheesman M.R., Mast N., Pikuleva I.A., Leys D., Munro A.W.J. Biol. Chem. 284:35524-35533(2009)
Mycobacterium tuberculosis CYP125A1, a steroid C27 monooxygenase that detoxifies intracellularly generated cholest-4-en-3-one.Ouellet H., Guan S., Johnston J.B., Chow E.D., Kells P.M., Burlingame A.L., Cox J.S., Podust L.M., de Montellano P.R.Mol. Microbiol. 77:730-742(2010)
Reverse type I inhibitor of Mycobacteriumtuberculosis CYP125A1.Ouellet H., Kells P.M., Ortiz de Montellano P.R., Podust L.M.Bioorg. Med. Chem. Lett. 21:332-337(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50.4 kDa
NCBI Official Full Name
steroid C26-monooxygenase
NCBI Official Symbol
cyp125
NCBI Protein Information
steroid C26-monooxygenase
UniProt Protein Name
Steroid C26-monooxygenase
Protein Family
UniProt Gene Name
cyp125
UniProt Entry Name
CP125_MYCTU
Uniprot Description
Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.
Research Articles on cyp125
Similar Products
Product Notes
The cyp125 cyp125 (Catalog #AAA1080108) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-433aa; Full Length. The amino acid sequence is listed below: MSWNHQSVEI AVRRTTVPSP NLPPGFDFTD PAIYAERLPV AEFAELRSAA PIWWNGQDPG KGGGFHDGGF WAITKLNDVK EISRHSDVFS SYENGVIPRF KNDIAREDIE VQRFVMLNMD APHHTRLRKI ISRGFTPRAV GRLHDELQER AQKIAAEAAA AGSGDFVEQV SCELPLQAIA GLLGVPQEDR GKLFHWSNEM TGNEDPEYAH IDPKASSAEL IGYAMKMAEE KAKNPADDIV TQLIQADIDG EKLSDDEFGF FVVMLAVAGN ETTRNSITQG MMAFAEHPDQ WELYKKVRPE TAADEIVRWA TPVTAFQRTA LRDYELSGVQ IKKGQRVVMF YRSANFDEEV FQDPFTFNIL RNPNPHVGFG GTGAHYCIGA NLARMTINLI FNAVADHMPD LKPISAPERL RSGWLNGIKH WQVDYTGRCP VAH. It is sometimes possible for the material contained within the vial of "Steroid C26-monooxygenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
