SDS-Page
Cytochrome b5 (CYB5A) Recombinant Protein | CYB5A recombinant protein
Recombinant Human Cytochrome b5 (CYB5A) , partial
Gene Names
CYB5A; CYB5; MCB5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b5 (CYB5A); Recombinant Human Cytochrome b5 (CYB5A); partial; CYB5A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
9-85aa, fragment, Cytochrome b5 heme-binding
Sequence
VKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELH
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,169 Da
NCBI Official Full Name
cytochrome b5 isoform 3
NCBI Official Synonym Full Names
cytochrome b5 type A
NCBI Official Symbol
CYB5A
NCBI Official Synonym Symbols
CYB5; MCB5
NCBI Protein Information
cytochrome b5
UniProt Protein Name
Cytochrome b5
Protein Family
UniProt Gene Name
CYB5A
UniProt Synonym Gene Names
CYB5; MCB5
NCBI Description
The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Uniprot Description
Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Research Articles on CYB5A
Similar Products
Product Notes
The CYB5A cyb5a (Catalog #AAA717370) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 9-85aa, fragment, Cytochrome b5 heme-binding. The amino acid sequence is listed below: VKYYTLEEIQ KHNHSKSTWL ILHHKVYDLT KFLEEHPGGE EVLREQAGGD ATENFEDVGH STDAREMSKT FIIGELH. It is sometimes possible for the material contained within the vial of "Cytochrome b5 (CYB5A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
