Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Monokine Induced By Interferon Gamma (MIg) Recombinant Protein | MIg recombinant protein

Recombinant Monokine Induced By Interferon Gamma (MIg)

Gene Names
CXCL9; CMK; MIG; Humig; SCYB9; crg-10
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
>95%
Synonyms
Monokine Induced By Interferon Gamma (MIg); Recombinant Monokine Induced By Interferon Gamma (MIg); MIg recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-TPVVRKGR CSCISTNQGT IHLQSLKDLK QFAPSPSCEK IEIIATLKNG VQTCLNPDSA DVKELIKKWE KQVSQKKKQK NGKKHQKKKV LKVRKSQRSR QKKTT
Sequence Length
125
Applicable Applications for MIg recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Homo sapiens (Human)
Expression System
Prokaryotic expression
Residues
Thr23~Thr125 (Accession # Q07325) with two N-terminal Tags, His-tag and T7-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.5kDa
NCBI Official Full Name
C-X-C motif chemokine 9
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 9
NCBI Official Symbol
CXCL9
NCBI Official Synonym Symbols
CMK; MIG; Humig; SCYB9; crg-10
NCBI Protein Information
C-X-C motif chemokine 9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma
UniProt Protein Name
C-X-C motif chemokine 9
UniProt Gene Name
CXCL9
UniProt Synonym Gene Names
CMK; MIG; SCYB9; HuMIG; MIG
UniProt Entry Name
CXCL9_HUMAN

NCBI Description

This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL9: Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: protein binding; CXCR3 chemokine receptor binding; chemokine activity; cytokine activity

Biological Process: response to lipopolysaccharide; defense response; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; positive regulation of myoblast differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; cell-cell signaling; cellular defense response; immune response; positive regulation of release of sequestered calcium ion into cytosol; inflammatory response; defense response to virus

Research Articles on MIg

Similar Products

Product Notes

The MIg cxcl9 (Catalog #AAA2010977) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Monokine Induced By Interferon Gamma (MIg) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the MIg cxcl9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-TPV VRKGR CSCISTNQGT IHLQSLKDLK QFAPSPSCEK IEIIATLKNG VQTCLNPDSA DVKELIKKWE KQVSQKKKQK NGKKHQKKKV LKVRKSQRSR QKKTT. It is sometimes possible for the material contained within the vial of "Monokine Induced By Interferon Gamma (MIg), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.