Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) ()

IL8 recombinant protein

IL8 protein (His tag)

Gene Names
CXCL8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1
Applications
ELISA, SDS-Page, Western Blot
Purity
> 90% pure
Synonyms
IL8; IL8 protein (His tag); IL-8 protein; IL 8 protein; C X C motif chemokine 8 protein; Emoctakin protein; Granulocyte chemotactic 1 protein; GCP 1 protein; Monocyte derived neutrophil chemotactic factor protein; MDNCF protein; Monocyte derived neutrophil activating peptide protein; MONAP protein; Neutrophil activating 1 protein; NAP 1 protein; Protein 3 10C protein; T cell chemotactic factor protein; Interleukin 8 protein; IL8 recombinant protein
Ordering
For Research Use Only!
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE  KFLKRAENS
Sequence Length
99
Applicable Applications for IL8 recombinant protein
ELISA (EIA), SDS-PAGE, Western Blot (WB)
Protein Type
Recombinant
Biological Significance
IL8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Expression System
E Coli
Tag/Conjugate
His tag
Preparation and Storage
Store at 4 degree C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 degree C, avoid repeat freeze/thaw cycles

Western Blot (WB)

()

Western Blot (WB) ()
Related Product Information for IL8 recombinant protein
Purified recombinant IL8 protein (His tag)
Product Categories/Family for IL8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
13 kDa
NCBI Official Full Name
IL8, partial
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 8
NCBI Official Symbol
CXCL8
NCBI Official Synonym Symbols
IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1
NCBI Protein Information
interleukin-8
UniProt Protein Name
Interleukin-8
UniProt Gene Name
CXCL8
UniProt Synonym Gene Names
IL8; IL-8; GCP-1; MDNCF; MONAP; NAP-1; LYNAP; NAF
UniProt Entry Name
IL8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq, Jul 2008]

Uniprot Description

IL8: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. Belongs to the intercrine alpha (chemokine CxC) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q13-q21

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; chemokine activity; interleukin-8 receptor binding

Biological Process: regulation of cell adhesion; neutrophil chemotaxis; neutrophil activation; unfolded protein response; negative regulation of G-protein coupled receptor protein signaling pathway; calcium-mediated signaling; signal transduction; chemotaxis; regulation of retroviral genome replication; induction of positive chemotaxis; G-protein coupled receptor protein signaling pathway; negative regulation of cell proliferation; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; receptor internalization; response to molecule of bacterial origin; immune response; angiogenesis; cell cycle arrest; cell motility; inflammatory response; embryonic gut development

Research Articles on IL8

Similar Products

Product Notes

The IL8 cxcl8 (Catalog #AAA5304394) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the IL8 cxcl8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EGAVLPRSAK ELRCQCIKTY SKPFHPKFIK ELRVIESGPH CANTEIIVKL SDGRELCLDP KENWVQRVVE  KFLKRAEN S. It is sometimes possible for the material contained within the vial of "IL8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.