Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Interleukin-8 (IL8) Recombinant Protein | IL8 recombinant protein

Recombinant Guinea pig Interleukin-8 (IL8)

Gene Names
Cxcl8; Il8; IL-8; NAP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-8 (IL8); Recombinant Guinea pig Interleukin-8 (IL8); IL8 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-101, Full length protein
Sequence
MVVTKLVSELRCQCIKIHTTPFHPKFIKELKVIESGPRCANSEIIVKLSDNRQLCLDPKKKWVQDVVSMFLKRTESQDS
Sequence Length
79
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IL8 recombinant protein
This protein is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,414 Da
NCBI Official Full Name
interleukin-8
NCBI Official Symbol
Cxcl8
NCBI Official Synonym Symbols
Il8; IL-8; NAP-1
NCBI Protein Information
interleukin-8
UniProt Protein Name
Interleukin-8
UniProt Gene Name
CXCL8
UniProt Synonym Gene Names
IL8; IL-8; NAP-1

Uniprot Description

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus ().

Similar Products

Product Notes

The IL8 cxcl8 (Catalog #AAA964804) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-101, Full length protein. The amino acid sequence is listed below: MVVTKLVSEL RCQCIKIHTT PFHPKFIKEL KVIESGPRCA NSEIIVKLSD NRQLCLDPKK KWVQDVVSMF LKRTESQDS. It is sometimes possible for the material contained within the vial of "Interleukin-8 (IL8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual