Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Growth-regulated alpha Recombinant Protein | CXCL1 recombinant protein

Recombinant Mouse Growth-regulated alpha protein

Gene Names
Cxcl1; KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth-regulated alpha; Recombinant Mouse Growth-regulated alpha protein; C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KC; Secretory protein N51; CXCL1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-96aa; Partial
Sequence
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Sequence Length
96
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CXCL1 recombinant protein
Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation. Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hatopoietic activity. 1 Publication
References
The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137(1989) Cloning and sequence of a secretory protein induced by growth factors in mouse fibroblasts.Ryseck R.P., Macdonald-Bravo H., Mattei M.-G., Bravo R.Exp. Cell Res. 180:266-275(1989) Bozic C.R., Kolakowski L.F. Jr., von Uexkull C., Garcia-Rodriguez M., Conklyn M.J., Breslow R., Showell H.J., Gerard N.P., Gerard C. Two structurally distinct kappa B sequence motifs cooperatively control LPS-induced KC gene transcription in mouse macrophages.Ohmori Y., Fukumoto S., Hamilton T.A.J. Immunol. 155:3593-3600(1995) Identification of unique truncated KC/GRO beta chemokines with potent hematopoietic and anti-infective activities.King A.G., Johanson K., Frey C.L., De;Marsh P.L., White J.R., McDevitt P., McNulty D., Balcarek J., Jonak Z.L., Bhatnagar P.K., Pelus L.M.J. Immunol. 164:3774-3782(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.5 kDa
NCBI Official Full Name
growth-regulated alpha protein
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 1
NCBI Official Symbol
Cxcl1
NCBI Official Synonym Symbols
KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1
NCBI Protein Information
growth-regulated alpha protein
UniProt Protein Name
Growth-regulated alpha protein
UniProt Gene Name
Cxcl1
UniProt Synonym Gene Names
Gro; Gro1; Mgsa; Scyb1; HSF
UniProt Entry Name
GROA_MOUSE

NCBI Description

This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung. [provided by RefSeq, Apr 2013]

Uniprot Description

CXCL2: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Cellular Component: cytosol; extracellular region; extracellular space

Molecular Function: chemokine activity; CXCR chemokine receptor binding; cytokine activity; growth factor activity

Biological Process: acute inflammatory response; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; neutrophil chemotaxis; positive regulation of potassium ion transport; positive regulation of superoxide release; response to lipopolysaccharide; response to molecule of bacterial origin

Research Articles on CXCL1

Similar Products

Product Notes

The CXCL1 cxcl1 (Catalog #AAA717372) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-96aa; Partial. The amino acid sequence is listed below: NELRCQCLQT MAGIHLKNIQ SLKVLPSGPH CTQTEVIATL KNGREACLDP EAPLVQKIVQ KMLKGVPK. It is sometimes possible for the material contained within the vial of "Growth-regulated alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.