Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CX3C chemokine receptor 1 (CX3CR1) Recombinant Protein | CX3CR1 recombinant protein

Recombinant Human CX3C chemokine receptor 1 (CX3CR1)

Gene Names
CX3CR1; V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CX3C chemokine receptor 1 (CX3CR1); Recombinant Human CX3C chemokine receptor 1 (CX3CR1); CX3CR1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-355. Full Length
Sequence
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CX3CR1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,969 Da
NCBI Official Full Name
CX3C chemokine receptor 1 isoform b
NCBI Official Synonym Full Names
C-X3-C motif chemokine receptor 1
NCBI Official Symbol
CX3CR1
NCBI Official Synonym Symbols
V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
NCBI Protein Information
CX3C chemokine receptor 1
UniProt Protein Name
CX3C chemokine receptor 1
Protein Family
UniProt Gene Name
CX3CR1
UniProt Synonym Gene Names
CMKBRL1; GPR13; C-X3-C CKR-1; CX3CR1; CMK-BRL1
UniProt Entry Name
CX3C1_HUMAN

NCBI Description

Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

CX3CR1: Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1. Defects in CX3CR1 are a cause of susceptibility to age- related macular degeneration type 12 (ARMD12). ARMD12 is a form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral; GPCR, family 1; Receptor, cytokine; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: integral to plasma membrane; neuron projection; perinuclear region of cytoplasm; plasma membrane

Molecular Function: C-X3-C chemokine binding; C-X3-C chemokine receptor activity; chemokine receptor activity; protein binding

Biological Process: cell adhesion; cellular defense response; cerebral cortex cell migration; chemotaxis; G-protein coupled receptor protein signaling pathway; macrophage chemotaxis; memory; microglial cell activation during immune response; negative regulation of angiogenesis; negative regulation of cell migration; negative regulation of chronic inflammatory response to non-antigenic stimulus; positive regulation of angiogenesis; positive regulation of neuroblast proliferation; response to wounding; viral reproduction

Disease: Coronary Heart Disease, Susceptibility To, 1; Human Immunodeficiency Virus Type 1, Susceptibility To; Macular Degeneration, Age-related, 12

Research Articles on CX3CR1

Similar Products

Product Notes

The CX3CR1 cx3cr1 (Catalog #AAA7013266) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-355. Full Length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CX3CR1 cx3cr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDQFPESVTE NFEYDDLAEA CYIGDIVVFG TVFLSIFYSV IFAIGLVGNL LVVFALTNSK KPKSVTDIYL LNLALSDLLF VATLPFWTHY LINEKGLHNA MCKFTTAFFF IGFFGSIFFI TVISIDRYLA IVLAANSMNN RTVQHGVTIS LGVWAAAILV AAPQFMFTKQ KENECLGDYP EVLQEIWPVL RNVETNFLGF LLPLLIMSYC YFRIIQTLFS CKNHKKAKAI KLILLVVIVF FLFWTPYNVM IFLETLKLYD FFPSCDMRKD LRLALSVTET VAFSHCCLNP LIYAFAGEKF RRYLYHLYGK CLAVLCGRSV HVDFSSSESQ RSRHGSVLSS NFTYHTSDGD ALLLL . It is sometimes possible for the material contained within the vial of "CX3C chemokine receptor 1 (CX3CR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.