Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cathepsin D (CTSD) Recombinant Protein | CTSD recombinant protein

Recombinant Bovine Cathepsin D (CTSD)

Gene Names
CTSD; CATD
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin D (CTSD); Recombinant Bovine Cathepsin D (CTSD); CTSD recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
45-390, Full length protein
Sequence
GPIPELLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYGSGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVTRQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEYMIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWILGDVFIGRYYTVFDRDQNRVGLAEAARL
Sequence Length
346
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CTSD recombinant protein
This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42,491 Da
NCBI Official Full Name
Cathepsin D
NCBI Official Symbol
CTSD
NCBI Official Synonym Symbols
CATD
NCBI Protein Information
cathepsin D
UniProt Protein Name
Cathepsin D
Protein Family
UniProt Gene Name
CTSD

Uniprot Description

Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation.

Research Articles on CTSD

Similar Products

Product Notes

The CTSD ctsd (Catalog #AAA967973) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-390, Full length protein. The amino acid sequence is listed below: GPIPELLKNY MDAQYYGEIG IGTPPQCFTV VFDTGSANLW VPSIHCKLLD IACWTHRKYN SDKSSTYVKN GTTFDIHYGS GSLSGYLSQD TVSVPCNPSS SSPGGVTVQR QTFGEAIKQP GVVFIAAKFD GILGMAYPRI SVNNVLPVFD NLMQQKLVDK NVFSFFLNRD PKAQPGGELM LGGTDSKYYR GSLMFHNVTR QAYWQIHMDQ LDVGSSLTVC KGGCEAIVDT GTSLIVGPVE EVRELQKAIG AVPLIQGEYM IPCEKVSSLP EVTVKLGGKD YALSPEDYAL KVSQAETTVC LSGFMGMDIP PPGGPLWILG DVFIGRYYTV FDRDQNRVGL AEAARL. It is sometimes possible for the material contained within the vial of "Cathepsin D (CTSD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.