Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CTGF Protein was determined by SDS-PAGE with Coomassie Blue, showing two bands at 16-25 kDa.)

CTGF recombinant protein

Recombinant Human CTGF Protein

Gene Names
CCN2; CTGF; NOV2; HCS24; IGFBP8
Purity
>95% by SDS-PAGE.
Synonyms
CTGF; Recombinant Human CTGF Protein; Connective tissue growth factor; CCN family member 2; Hypertrophic chondrocyte-specific protein 24; Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8; CTGF recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
Sequence Length
349
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CTGF Protein was determined by SDS-PAGE with Coomassie Blue, showing two bands at 16-25 kDa.)

SDS-Page (Recombinant Human CTGF Protein was determined by SDS-PAGE with Coomassie Blue, showing two bands at 16-25 kDa.)
Related Product Information for CTGF recombinant protein
Description: Recombinant Human CTGF Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln27-Ala180) of human CTGF (Accession #P29279) fused with a No tag.

Background: This protein is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
Product Categories/Family for CTGF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CCN family member 2
NCBI Official Synonym Full Names
cellular communication network factor 2
NCBI Official Symbol
CCN2
NCBI Official Synonym Symbols
CTGF; NOV2; HCS24; IGFBP8
NCBI Protein Information
CCN family member 2
UniProt Protein Name
Connective tissue growth factor
UniProt Gene Name
CTGF
UniProt Synonym Gene Names
CCN2; HCS24; IGFBP8; IBP-8; IGF-binding protein 8; IGFBP-8
UniProt Entry Name
CTGF_HUMAN

NCBI Description

The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis. [provided by RefSeq, Nov 2009]

Uniprot Description

CTGF: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Belongs to the CCN family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Cell adhesion

Chromosomal Location of Human Ortholog: 6q23.1

Cellular Component: Golgi apparatus; proteinaceous extracellular matrix; extracellular space; cis-Golgi network; intracellular membrane-bound organelle; perinuclear region of cytoplasm; plasma membrane; extracellular region; cell cortex; cytosol

Molecular Function: integrin binding; heparin binding; insulin-like growth factor binding; protein binding; growth factor activity; fibronectin binding

Biological Process: response to peptide hormone stimulus; epidermis development; response to anoxia; cell-matrix adhesion; positive regulation of collagen biosynthetic process; positive regulation of caspase activity; positive regulation of JNK cascade; cellular lipid metabolic process; response to estradiol stimulus; cell-cell signaling; positive regulation of stress fiber formation; positive regulation of cell proliferation; response to glucose stimulus; tissue homeostasis; response to wounding; angiogenesis; regulation of cell growth; cell differentiation; cell adhesion; positive regulation of cell activation; cartilage condensation; integrin-mediated signaling pathway; transcription initiation from RNA polymerase II promoter; cell migration; ossification; fibroblast growth factor receptor signaling pathway; organ senescence; response to mineralocorticoid stimulus; response to amino acid stimulus; gene expression; regulation of chondrocyte differentiation; positive regulation of protein amino acid phosphorylation; positive regulation of cell differentiation; lung development

Research Articles on CTGF

Similar Products

Product Notes

The CTGF ctgf (Catalog #AAA9141927) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QNCSGPCRCP DEPAPRCPAG VSLVLDGCGC CRVCAKQLGE LCTERDPCDP HKGLFCDFGS PANRKIGVCT AKDGAPCIFG GTVYRSGESF QSSCKYQCTC LDGAVGCMPL CSMDVRLPSP DCPFPRRVKL PGKCCEEWVC DEPKDQTVVG PALA. It is sometimes possible for the material contained within the vial of "CTGF, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.