Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1) Recombinant Protein | CTDSP1 recombinant protein

Recombinant Human Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1)

Cat. Num. AAA1377127

• Gene Names: CTDSP1; NIF3; SCP1; NLIIF; NLI-IF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1); Recombinant Human Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1); CTDSP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-261, Full length protein
• Sequence: MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS
• Sequence Length: 261

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 332308973
• NCBI GeneID: 58190
• NCBI Accession #: NP_001193807.1
• NCBI GenBank Nucleotide #: NM_001206878.1
• UniProt Accession #: Q9GZU7; Q7Z5Q3; Q7Z5Q4; C9IYG0
• Molecular Weight: 29,128 Da
• NCBI Official Full Name: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 3
• NCBI Official Synonym Full Names: CTD small phosphatase 1
• NCBI Official Symbol: CTDSP1
• NCBI Official Synonym Symbols: NIF3; SCP1; NLIIF; NLI-IF
• NCBI Protein Information: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
• UniProt Protein Name: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
• Protein Family: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase
• UniProt Gene Name: CTDSP1
• UniProt Synonym Gene Names: NIF3; NLIIF; SCP1; NLI-IF; NLI-interacting factor 3; SCP1; Small CTD phosphatase 1

NCBI Description

This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats of the C-terminal domain of RNA polymerase II. The encoded protein plays a role in neuronal gene silencing in non-neuronal cells, and may also inhibit osteoblast differentiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.