Uncharacterized protein At3g63140, chloroplastic (At3g63140) Recombinant Protein | At3g63140 recombinant protein
Recombinant Arabidopsis thaliana Uncharacterized protein At3g63140, chloroplastic (At3g63140)
Gene Names
CSP41A; chloroplast stem-loop binding protein of 41 kDa; chloroplast stem-loop binding protein of 41 kDa
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein At3g63140; chloroplastic (At3g63140); Recombinant Arabidopsis thaliana Uncharacterized protein At3g63140; At3g63140 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
73-406, Full length protein
Sequence
ASSVGEKKNVLIVNTNSGGHAVIGFYFAKELLSAGHAVTILTVGDESSEKMKKPPFNRFSEIVSGGGKTVWGNPANVANVVGGETFDVVLDNNGKDLDTVRPVVDWAKSSGVKQFLFISSAGIYKSTEQPPHVEGDAVKADAGHVVVEKYLAETFGNWASFRPQYMIGSGNNKDCEEWFFDRIVRDRAVPIPGSGLQLTNISHVRDLSSMLTSAVANPEAASGNIFNCVSDRAVTLDGMAKLCAAAAGKTVEIVHYDPKAIGVDAKKAFLFRNMHFYAEPRAAKDLLGWESKTNLPEDLKERFEEYVKIGRDKKEIKFELDDKILEALKTPVAA
Sequence Length
334
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,930 Da
NCBI Official Full Name
chloroplast stem-loop binding protein of 41 kDa
NCBI Official Symbol
CSP41A
NCBI Official Synonym Symbols
chloroplast stem-loop binding protein of 41 kDa; chloroplast stem-loop binding protein of 41 kDa
NCBI Protein Information
chloroplast stem-loop binding protein of 41 kDa
UniProt Protein Name
Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic
UniProt Gene Name
CSP41A
UniProt Synonym Gene Names
CSP41-a
NCBI Description
Encodes a protein with ribonuclease activity that is involved in plastid rRNA maturation.
Uniprot Description
Binds and cleaves RNA, particularly in stem-loops. Associates with pre-ribosomal particles in chloroplasts, and participates in chloroplast ribosomal RNA metabolism, probably during the final steps of 23S rRNA maturation. May enhance transcription by the plastid-encoded polymerase and translation in plastid via the stabilization of ribosome assembly intermediates. Required for chloroplast integrity. Involved in the regulation of the circadian system.
Research Articles on At3g63140
Similar Products
Product Notes
The At3g63140 csp41a (Catalog #AAA1281274) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 73-406, Full length protein. The amino acid sequence is listed below: ASSVGEKKNV LIVNTNSGGH AVIGFYFAKE LLSAGHAVTI LTVGDESSEK MKKPPFNRFS EIVSGGGKTV WGNPANVANV VGGETFDVVL DNNGKDLDTV RPVVDWAKSS GVKQFLFISS AGIYKSTEQP PHVEGDAVKA DAGHVVVEKY LAETFGNWAS FRPQYMIGSG NNKDCEEWFF DRIVRDRAVP IPGSGLQLTN ISHVRDLSSM LTSAVANPEA ASGNIFNCVS DRAVTLDGMA KLCAAAAGKT VEIVHYDPKA IGVDAKKAFL FRNMHFYAEP RAAKDLLGWE SKTNLPEDLK ERFEEYVKIG RDKKEIKFEL DDKILEALKT PVAA. It is sometimes possible for the material contained within the vial of "Uncharacterized protein At3g63140, chloroplastic (At3g63140), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
