Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable xyloglucan glycosyltransferase 2 (CSLC2) Recombinant Protein | CSLC2 recombinant protein

Recombinant Oryza sativa subsp. indica Probable xyloglucan glycosyltransferase 2 (CSLC2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable xyloglucan glycosyltransferase 2 (CSLC2); Recombinant Oryza sativa subsp. indica Probable xyloglucan glycosyltransferase 2 (CSLC2); CSLC2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-698aa; full length protein
Sequence
MAPPGVGVGVAYLWGKGRGGRKGTPVVVTMESPNYSVVEVDGPDAEAELRTAAVAMDKGG GRGRSRSRTARQLTWVLLLRARRAAGRLASFAAAAARRFRRSPADAADELGRGRGRLMYG FIRGFLALSLLALAVELAAYWNGWRLRRPELHVPEAVEIEGWAHSAYISWMSFRADYIRR PIEFLSKACILLFVIQSMDRLVLCLGCFWIKLRKIKPRIEGDPFREGSGYQHPMVLVQIP MCNEKEVYEQSISAACQLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSHQGVNIVYRH RVLRTGYKAGNLKSAMSCDYVKDYEFVAIFDADFQPTPDFLKKTIPHFEGNPELGLVQAR WSFVNKDENLLTRLQNINLCFHFEVEQQVNGVFLNFFGFNGTAGVWRIQALEESGGWLER TTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGPMHLFWLCLPDI LTAKISSWKKANLILLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPVWVICYVPVCM SFLNILPSPRSFPFIVPYLLFENTMSVTKFNAMVSGLFKLGSSYEWIVTKKSGRSSESDL STAVERDTKDLTLPRLQKQISESELIDLKMQKERQEKAPLGAKKANKIYKKELALSLLLL TAATRSLLSAQGIHFYFLLFQGVSFLFVGLDLIGEQID
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Oryza sativa subsp. indica (Rice)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CSLC2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
79,374 Da
NCBI Official Full Name
Probable xyloglucan glycosyltransferase 2
UniProt Protein Name
Probable xyloglucan glycosyltransferase 2
UniProt Gene Name
CSLC2
UniProt Entry Name
CSLC2_ORYSI

Uniprot Description

Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose ().

Similar Products

Product Notes

The CSLC2 cslc2 (Catalog #AAA7013117) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-698aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CSLC2 cslc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPPGVGVGV AYLWGKGRGG RKGTPVVVTM ESPNYSVVEV DGPDAEAELR TAAVAMDKGG GRGRSRSRTA RQLTWVLLLR ARRAAGRLAS FAAAAARRFR RSPADAADEL GRGRGRLMYG FIRGFLALSL LALAVELAAY WNGWRLRRPE LHVPEAVEIE GWAHSAYISW MSFRADYIRR PIEFLSKACI LLFVIQSMDR LVLCLGCFWI KLRKIKPRIE GDPFREGSGY QHPMVLVQIP MCNEKEVYEQ SISAACQLDW PREKFLIQVL DDSSDESIQL LIKAEVSKWS HQGVNIVYRH RVLRTGYKAG NLKSAMSCDY VKDYEFVAIF DADFQPTPDF LKKTIPHFEG NPELGLVQAR WSFVNKDENL LTRLQNINLC FHFEVEQQVN GVFLNFFGFN GTAGVWRIQA LEESGGWLER TTVEDMDIAV RAHLNGWKFI FLNDVKVLCE LPESYEAYRK QQHRWHSGPM HLFWLCLPDI LTAKISSWKK ANLILLFFLL RKLILPFYSF TLFCVILPLT MFVPEAELPV WVICYVPVCM SFLNILPSPR SFPFIVPYLL FENTMSVTKF NAMVSGLFKL GSSYEWIVTK KSGRSSESDL STAVERDTKD LTLPRLQKQI SESELIDLKM QKERQEKAPL GAKKANKIYK KELALSLLLL TAATRSLLSA QGIHFYFLLF QGVSFLFVGL DLIGEQID. It is sometimes possible for the material contained within the vial of "Probable xyloglucan glycosyltransferase 2 (CSLC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.