Putative xyloglucan glycosyltransferase 10 (CSLC10) Recombinant Protein | CSLC10 recombinant protein
Recombinant Oryza sativa subsp. indica Putative xyloglucan glycosyltransferase 10 (CSLC10)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative xyloglucan glycosyltransferase 10 (CSLC10); Recombinant Oryza sativa subsp. indica Putative xyloglucan glycosyltransferase 10 (CSLC10); Recombinant Putative xyloglucan glycosyltransferase 10 (CSLC10); Putative xyloglucan glycosyltransferase 10 EC= 2.4.1.-; Cellulose synthase-like protein C10 OsCslC10; CSLC10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-686
Sequence
MAPWSGFWAASRPALAAAAAGGTPVVVKMDNPNWSISEIDADGGEFLAGGRRRGRGKNAKQITWVLLLKAHRAAGCLAWLASAAVALGAAARRRVAAGRTDDADAETPAPRSRLYAFIRASLLLSVFLLAVELAAHANGRGRVLAASVDSFHSSWVRFRAAYVAPPLQLLADACVVLFLVQSADRLVQCLGCLYIHLNRIKPKPISSPAAAAAALPDLEDPDAGDYYPMVLVQIPMCNEKEVYQQSIAAVCNLDWPRSNILVQVLDDSDDPITQSLIKEEVEKWRQNGARIVYRHRVLREGYKAGNLKSAMSCSYVKDYEYVAIFDADFQPYPDFLKRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQNINLCFHFEVEQQVNGIFINFFGFNGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLNGWKFVFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRCKIAFWKKANLIFLFFLLRKLILPFYSFTLFCIILPMTMFIPEAELPDWVVCYIPALMSFLNILPAPKSFPFIIPYLLFENTMSVTKFNAMISGLFQLGSAYEWVVTKKSGRSSEGDLIALAPKELKQQKILDLTAIKEQSMLKQSSPRNEAKKKYNRIYKKELALSLLLLTAAARSLLSKQGIHFYFLMFQGLSFLLVGLDLIGEDVK
Sequence Length
686
Species
Oryza sativa subsp. indica (Rice)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
77,176 Da
UniProt Protein Name
Putative xyloglucan glycosyltransferase 10
Protein Family
UniProt Gene Name
CSLC10
UniProt Entry Name
CSLCA_ORYSI
Uniprot Description
Function: Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose
By similarity.
Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the glycosyltransferase 2 family. Plant cellulose synthase-like C subfamily.
Similar Products
Product Notes
The Putative xyloglucan glycosyltransferase 10 (CSLC10) cslc10 (Catalog #AAA1088423) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-686. The amino acid sequence is listed below: MAPWSGFWAA SRPALAAAAA GGTPVVVKMD NPNWSISEID ADGGEFLAGG RRRGRGKNAK QITWVLLLKA HRAAGCLAWL ASAAVALGAA ARRRVAAGRT DDADAETPAP RSRLYAFIRA SLLLSVFLLA VELAAHANGR GRVLAASVDS FHSSWVRFRA AYVAPPLQLL ADACVVLFLV QSADRLVQCL GCLYIHLNRI KPKPISSPAA AAAALPDLED PDAGDYYPMV LVQIPMCNEK EVYQQSIAAV CNLDWPRSNI LVQVLDDSDD PITQSLIKEE VEKWRQNGAR IVYRHRVLRE GYKAGNLKSA MSCSYVKDYE YVAIFDADFQ PYPDFLKRTV PHFKDNEELG LVQARWSFVN KDENLLTRLQ NINLCFHFEV EQQVNGIFIN FFGFNGTAGV WRIKALEDSG GWMERTTVED MDIAVRAHLN GWKFVFLNDV ECQCELPESY EAYRKQQHRW HSGPMQLFRL CLPDIIRCKI AFWKKANLIF LFFLLRKLIL PFYSFTLFCI ILPMTMFIPE AELPDWVVCY IPALMSFLNI LPAPKSFPFI IPYLLFENTM SVTKFNAMIS GLFQLGSAYE WVVTKKSGRS SEGDLIALAP KELKQQKILD LTAIKEQSML KQSSPRNEAK KKYNRIYKKE LALSLLLLTA AARSLLSKQG IHFYFLMFQG LSFLLVGLDL IGEDVK. It is sometimes possible for the material contained within the vial of "Putative xyloglucan glycosyltransferase 10 (CSLC10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
