Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mediator of RNA polymerase II transcription subunit 9 (CSE2) Recombinant Protein | CSE2 recombinant protein

Recombinant Saccharomyces cerevisiae Mediator of RNA polymerase II transcription subunit 9 (CSE2)

Gene Names
CSE2; MED9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mediator of RNA polymerase II transcription subunit 9 (CSE2); Recombinant Saccharomyces cerevisiae Mediator of RNA polymerase II transcription subunit 9 (CSE2); CSE2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-149, full length protein
Sequence
MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR
Sequence Length
149
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,376 Da
NCBI Official Full Name
Cse2p
NCBI Official Symbol
CSE2
NCBI Official Synonym Symbols
MED9
NCBI Protein Information
Cse2p
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 9
Protein Family
UniProt Gene Name
CSE2
UniProt Synonym Gene Names
MED9

Uniprot Description

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.

Research Articles on CSE2

Similar Products

Product Notes

The CSE2 cse2 (Catalog #AAA1180474) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-149, full length protein. The amino acid sequence is listed below: MNLQNNVLNQ IHQILLPTNP TLDKPNAEAT KEEFSSAENR DEKDYLTNQQ PKNLSTPSTS SNGEFIPHIF YSLHQIRKDP NNLSNQLETL TGSIRHRLKL CKSLISENED TKDLLSKSPS EWQDIIHQRE QELQIKRDVL DDLYRKLQR. It is sometimes possible for the material contained within the vial of "Mediator of RNA polymerase II transcription subunit 9 (CSE2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.