Uncharacterized sufE-like protein ygdK (ygdK) Recombinant Protein | ygdK recombinant protein
Recombinant Escherichia coli O157:H7 Uncharacterized sufE-like protein ygdK (ygdK)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized sufE-like protein ygdK (ygdK); Recombinant Escherichia coli O157:H7 Uncharacterized sufE-like protein ygdK (ygdK); ygdK recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147, Full length protein
Sequence
MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQV
Sequence Length
147
Species
Escherichia coli O157:H7
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15,940 Da
NCBI Official Full Name
hypothetical protein ECs3671
NCBI Official Symbol
ECs3671
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Sulfur acceptor protein CsdE
UniProt Gene Name
csdE
UniProt Synonym Gene Names
ygdK
Uniprot Description
Stimulates the cysteine desulfurase activity of CsdA. Contains a cysteine residue (Cys-61) that acts to accept sulfur liberated via the desulfurase activity of CsdA. May be able to transfer sulfur to TcdA/CsdL. Seems to support the function of TcdA in the generation of cyclic threonylcarbamoyladenosine at position 37 (ct6A37) in tRNAs that read codons beginning with adenine. Does not appear to participate in Fe/S biogenesis ().
Similar Products
Product Notes
The ygdK csde (Catalog #AAA1020507) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147, Full length protein. The amino acid sequence is listed below: MTNPQFAGHP FGTTVTAETL RNTFAPLTQW EDKYRQLIML GKQLPALPDE LKAQAKEIAG CENRVWLGYT VAENGKMHFF GDSEGRIVRG LLAVLLTAVE GKTAAELQAQ SPLALFDELG LRAQLSASRS QGLNALSEAI IAATKQV. It is sometimes possible for the material contained within the vial of "Uncharacterized sufE-like protein ygdK (ygdK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
