Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Crystallin Lambda 1 (CRYl1) Recombinant Protein | CRYl1 recombinant protein

Recombinant Crystallin Lambda 1 (CRYl1)

Gene Names
CRYL1; GDH; HEL30; lambda-CRY
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Crystallin Lambda 1 (CRYl1); Recombinant Crystallin Lambda 1 (CRYl1); CRYl1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH IQECVPEDLE LKKKIFAQLD SIIDDRVILS SSTSCLMPSK LFAGLVHVKQ CIVAHPVNPP YYIPLVELVP HPETAPTTVD RTHALMKKIG QCPMRVQKEV AGFVLNRLQY AIISEAWRLV EEGIVSPSDL DLVMSEGLGM RY
Sequence Length
319
Applicable Applications for CRYl1 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Homo sapiens (Human)
Expression System
Prokaryotic expression
Residues
Leu24~Tyr232 (Accession # Q9Y2S2) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.9kDa
NCBI Official Full Name
lambda-crystallin homolog
NCBI Official Synonym Full Names
crystallin, lambda 1
NCBI Official Symbol
CRYL1
NCBI Official Synonym Symbols
GDH; HEL30; lambda-CRY
NCBI Protein Information
lambda-crystallin homolog; gul3DH; crystallin, lamda 1; L-gulonate 3-dehydrogenase; epididymis luminal protein 30
UniProt Protein Name
Lambda-crystallin homolog
Protein Family
UniProt Gene Name
CRYL1
UniProt Synonym Gene Names
CRY; Gul3DH
UniProt Entry Name
CRYL1_HUMAN

NCBI Description

The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]

Uniprot Description

CRYL1: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]

Protein type: EC 1.1.1.45

Chromosomal Location of Human Ortholog: 13q12.11

Cellular Component: Golgi apparatus; cytoplasm; plasma membrane; nucleolus; nucleus; cytosol

Molecular Function: L-gulonate 3-dehydrogenase activity; protein homodimerization activity; 3-hydroxyacyl-CoA dehydrogenase activity

Biological Process: fatty acid metabolic process

Research Articles on CRYl1

Similar Products

Product Notes

The CRYl1 cryl1 (Catalog #AAA2011800) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Crystallin Lambda 1 (CRYl1) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CRYl1 cryl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-LFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH IQECVPEDLE LKKKIFAQLD SIIDDRVILS SSTSCLMPSK LFAGLVHVKQ CIVAHPVNPP YYIPLVELVP HPETAPTTVD RTHALMKKIG QCPMRVQKEV AGFVLNRLQY AIISEAWRLV EEGIVSPSDL DLVMSEGLGM RY. It is sometimes possible for the material contained within the vial of "Crystallin Lambda 1 (CRYl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.