Sensor protein CreC (creC) Recombinant Protein | creC recombinant protein
Recombinant Escherichia coli Sensor protein CreC (creC)
Gene Names
creC; ECK4391; JW4362; phoM
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sensor protein CreC (creC); Recombinant Escherichia coli Sensor protein CreC (creC); creC recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-474aa; full length protein
Sequence
MRIGMRLLLGYFLLVAVAAWFVLAIFVKEVKPGVRRATEGTLIDTATLLAELARPDLLSG DPTHGQLAQAFNQLQHRPFRANIGGINKVRNEYHVYMTDAQGKVLFDSANKAVGQDYSRW NDVWLTLRGQYGARSTLQNPADPESSVMYVAAPIMDGSRLIGVLSVGKPNAAMAPVIKRS ERRILWASAILLGIALVIGAGMVWWINRSIARLTRYADSVTDNKPVPLPDLGSSELRKLA QALESMRVKLEGKNYIEQYVYALTHELKSPLAAIRGAAEILREGPPPEVVARFTDNILTQ NARMQALVETLLRQARLENRQEVVLTAVDVAALFRRVSEARTVQLAEKKITLHVTPTEVN VAAEPALLEQALGNLLDNAIDFTPESGCITLSAEVDQEHVTLKVLDTGSGIPDYALSRIF ERFYSLPRANGQKSSGLGLAFVSEVARLFNGEVTLRNVQEGGVLASLRLHRHFT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for creC recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,176 Da
NCBI Official Full Name
sensory histidine kinase in two-component regulatory system with CreB or PhoB
NCBI Official Symbol
creC
NCBI Official Synonym Symbols
ECK4391; JW4362; phoM
NCBI Protein Information
sensory histidine kinase in two-component regulatory system with CreB or PhoB
UniProt Protein Name
Sensor protein CreC
Protein Family
UniProt Gene Name
creC
UniProt Synonym Gene Names
phoM
UniProt Entry Name
CREC_ECOLI
NCBI Description
CreC belongs to the two component system CreC/CreB , and is involved in phosphate limitation . [More information is available at EcoCyc: EG10730].
Uniprot Description
Member of the two-component regulatory system CreC/CreB involved in catabolic regulation. CreC may function as a membrane-associated protein kinase that phosphorylates CreB in response to environmental signals. CreC can also phosphorylate PhoB.
Research Articles on creC
Similar Products
Product Notes
The creC crec (Catalog #AAA7013038) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-474aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the creC crec for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRIGMRLLLG YFLLVAVAAW FVLAIFVKEV KPGVRRATEG TLIDTATLLA ELARPDLLSG DPTHGQLAQA FNQLQHRPFR ANIGGINKVR NEYHVYMTDA QGKVLFDSAN KAVGQDYSRW NDVWLTLRGQ YGARSTLQNP ADPESSVMYV AAPIMDGSRL IGVLSVGKPN AAMAPVIKRS ERRILWASAI LLGIALVIGA GMVWWINRSI ARLTRYADSV TDNKPVPLPD LGSSELRKLA QALESMRVKL EGKNYIEQYV YALTHELKSP LAAIRGAAEI LREGPPPEVV ARFTDNILTQ NARMQALVET LLRQARLENR QEVVLTAVDV AALFRRVSEA RTVQLAEKKI TLHVTPTEVN VAAEPALLEQ ALGNLLDNAI DFTPESGCIT LSAEVDQEHV TLKVLDTGSG IPDYALSRIF ERFYSLPRAN GQKSSGLGLA FVSEVARLFN GEVTLRNVQE GGVLASLRLH RHFT. It is sometimes possible for the material contained within the vial of "Sensor protein CreC (creC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
