Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) Recombinant Protein | CREB3L3 recombinant protein

Recombinant Human Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3), partial

Gene Names
CREB3L3; CREBH; CREB-H; HYST1481
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3); Recombinant Human Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3); partial; CREB3L3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-322. Partial
Sequence
MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDSDDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGT
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,845 Da
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3-like protein 3 isoform b
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3 like 3
NCBI Official Symbol
CREB3L3
NCBI Official Synonym Symbols
CREBH; CREB-H; HYST1481
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3-like protein 3
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 3-like protein 3
UniProt Gene Name
CREB3L3
UniProt Synonym Gene Names
CREBH; cAMP-responsive element-binding protein 3-like protein 3

NCBI Description

This gene encodes a member of the basic-leucine zipper family and the AMP-dependent transcription factor family. The encoded protein is localized to the endoplasmic reticulum and acts as a transcription factor activated by cyclic AMP stimulation. The encoded protein binds the cyclic AMP response element (CRE) and the box-B element and has been linked to acute inflammatory response, hepatocellular carcinoma, triglyceride metabolism, and hepcidin expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]

Uniprot Description

Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activates transcription through box-B element. Activates transcription through CRE (). Seems to function synergistically with ATF6. In acute inflammatory response, may activate expression of acute phase response (APR) genes. May be involved in growth suppression.

Research Articles on CREB3L3

Similar Products

Product Notes

The CREB3L3 creb3l3 (Catalog #AAA1364736) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-322. Partial. The amino acid sequence is listed below: MNTDLAAGKM ASAACSMDPI DSFELLDLLF DRQDGILRHV ELGEGWGHVK DQQVLPNPDS DDFLSSILGS GDSLPSSPLW SPEGSDSGIS EDLPSDPQDT PPRSGPATSP AGCHPAQPGK GPCLSYHPGN SCSTTTPGPV IQVPEASVTI DLEMWSPGGR ICAEKPADPV DLSPRCNLTV KDLLLSGSSG DLQQHHLGAS YLLRPGAGHC QELVLTEDEK KLLAKEGITL PTQLPLTKYE ERVLKKIRRK IRNKQSAQES RKKKKEYIDG LETRMSACTA QNQELQRKVL HLEKQNLSLL EQLKKLQAIV VQSTSKSAQT GT . It is sometimes possible for the material contained within the vial of "Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.