Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Crustacean hyperglycemic hormones Recombinant Protein | CPRP recombinant protein

Recombinant Carcinus maenas Crustacean hyperglycemic hormones, partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Crustacean hyperglycemic hormones; Recombinant Carcinus maenas Crustacean hyperglycemic hormones; partial; Recombinant Crustacean hyperglycemic hormones; Crustacean hyperglycemic hormones Cleaved into the following 2 chains: 1. CHH precursor-related peptide; 2. CPRP 3. Crustacean hyperglycemic hormone; 4. CHH; CPRP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
67-138. Partial, covers the Crustacean hyperglycemic hormone Peptide
Sequence
QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV
Species
Carcinus maenas (Common shore crab) (Green crab)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
16.0 kDa
NCBI Official Full Name
Crustacean hyperglycemic hormones
UniProt Protein Name
Crustacean hyperglycemic hormones
UniProt Gene Name
CPRP
UniProt Synonym Gene Names
CHH
UniProt Entry Name
CHH_CARMA

Uniprot Description

Function: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.

Subcellular location: Secreted.

Tissue specificity: Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.

Post-translational modification: The N-terminus is blocked only in isoform CHH-II but not in isoform CHH-I.

Sequence similarities: Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.

Mass spectrometry: Molecular mass is 8538.3±1 Da from positions 67 - 138. Determined by ESI. Ref.4

Similar Products

Product Notes

The Crustacean hyperglycemic hormones cprp (Catalog #AAA1140216) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 67-138. Partial, covers the Crustacean hyperglycemic hormone Peptide. The amino acid sequence is listed below: QIYDTSCKGV YDRALFNDLE HVCDDCYNLY RTSYVASACR SNCYSNLVFR QCMDDLLMMD EFDQYARKVQ MV. It is sometimes possible for the material contained within the vial of "Crustacean hyperglycemic hormones, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.