Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Carboxypeptidase B2 (Cpb2) Recombinant Protein | Cpb2 recombinant protein

Recombinant Mouse Carboxypeptidase B2 (Cpb2)

Gene Names
Cpb2; CPR; Cpu; TAFI; AI255929; 1110032P04Rik; 4930405E17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carboxypeptidase B2 (Cpb2); Recombinant Mouse Carboxypeptidase B2 (Cpb2); Cpb2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
114-422, full length protein
Sequence
ASASYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIVWHVIRNT
Sequence Length
309
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cpb2 recombinant protein
Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). This protein is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis. Polymorphisms have been described for this gene and its promoter region. Available sequence data analyses indicate splice variants that encode different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,871 Da
NCBI Official Full Name
carboxypeptidase B2 preproprotein
NCBI Official Synonym Full Names
carboxypeptidase B2 (plasma)
NCBI Official Symbol
Cpb2
NCBI Official Synonym Symbols
CPR; Cpu; TAFI; AI255929; 1110032P04Rik; 4930405E17Rik
NCBI Protein Information
carboxypeptidase B2
UniProt Protein Name
Carboxypeptidase B2
Protein Family
UniProt Gene Name
Cpb2
UniProt Synonym Gene Names
Tafi; CPR; CPU; TAFI

NCBI Description

This gene encodes carboxypeptidase B, a zinc-dependent metalloprotease that cleaves peptide bonds at the C-terminus of protein substrates. The encoded preproprotein undergoes proteolytic activation to generate a mature, functional enzyme, and secreted into plasma. [provided by RefSeq, Jan 2016]

Uniprot Description

Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. Down-regulates fibrinolysis by removing C-terminal lysine residues from fibrin that has already been partially degraded by plasmin.

Research Articles on Cpb2

Similar Products

Product Notes

The Cpb2 cpb2 (Catalog #AAA1289904) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 114-422, full length protein. The amino acid sequence is listed below: ASASYYEQYH SLNEIYSWIE VITEQHPDML QKIYIGSSFE KYPLYVLKVS GKEQRIKNAI WIDCGIHARE WISPAFCLWF IGYVTQFHGK ENLYTRLLRH VDFYIMPVMN VDGYDYTWKK NRMWRKNRSA HKNNRCVGTD LNRNFASKHW CEKGASSSSC SETYCGLYPE SEPEVKAVAD FLRRNIDHIK AYISMHSYSQ QILFPYSYNR SKSKDHEELS LVASEAVRAI ESINKNTRYT HGSGSESLYL APGGSDDWIY DLGIKYSFTI ELRDTGRYGF LLPERYIKPT CAEALAAISK IVWHVIRNT. It is sometimes possible for the material contained within the vial of "Carboxypeptidase B2 (Cpb2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.