Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cytochrome c oxidase subunit 5A Recombinant Protein | COX5A recombinant protein

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial

Gene Names
COX5A; VA; COX; COX-VA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 5A; Recombinant Human Cytochrome c oxidase subunit 5A; mitochondrial; Cytochrome c oxidase polypeptide Va; COX5A recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
42-150aa; Full Length
Sequence
SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Sequence Length
150
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for COX5A recombinant protein
This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Product Categories/Family for COX5A recombinant protein
References
Subunit Va of human and bovine cytochrome c oxidase is highly conserved.Rizzuto R., Nakase H., Zeviani M., Dimauro S., Schon E.A.Gene 69:245-256(1988) Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates.Uddin M., Opazo J.C., Wildman D.E., Sherwood C.C., Hof P.R., Goodman M., Grossman L.I.BMC Evol. Biol. 8:8-8(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.5 kDa
NCBI Official Full Name
cytochrome c oxidase subunit 5A, mitochondrial
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 5A
NCBI Official Symbol
COX5A
NCBI Official Synonym Symbols
VA; COX; COX-VA
NCBI Protein Information
cytochrome c oxidase subunit 5A, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 5A, mitochondrial
Protein Family
UniProt Gene Name
COX5A
UniProt Entry Name
COX5A_HUMAN

NCBI Description

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22. [provided by RefSeq, Jul 2008]

Uniprot Description

COX5A: This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Belongs to the cytochrome c oxidase subunit 5A family.

Protein type: EC 1.9.3.1; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Oxidoreductase

Chromosomal Location of Human Ortholog: 15q24.1

Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex IV; myelin sheath

Molecular Function: cytochrome-c oxidase activity; electron carrier activity; metal ion binding; protein binding

Biological Process: cellular metabolic process; gene expression; mitochondrial electron transport, cytochrome c to oxygen; transcription initiation from RNA polymerase II promoter

Research Articles on COX5A

Similar Products

Product Notes

The COX5A cox5a (Catalog #AAA717269) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 42-150aa; Full Length. The amino acid sequence is listed below: SHGSQETDEE FDARWVTYFN KPDIDAWELR KGINTLVTYD MVPEPKIIDA ALRACRRLND FASTVRILEV VKDKAGPHKE IYPYVIQELR PTLNELGIST PEELGLDKV. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 5A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.