COVID 19 Spike RBD (Delta Plus Variant) (K417N, L452R, T478K) Coronavirus Recombinant Protein | COVID-19 recombinant protein

Spike RBD Protein of SARS-CoV-2 (Delta Plus Variant)

Cat. Num. AAA434309

• Applications: Western Blot, ELISA
• Purity: >= 95% (by SDS PAGE)
• Synonyms: COVID 19 Spike RBD (Delta Plus Variant) (K417N; L452R; T478K) Coronavirus; Spike RBD Protein of SARS-CoV-2 (Delta Plus Variant); 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Spike RBD; Delta Plus Variant; K417N; T478K; COVID-19 recombinant protein

• Purity/Purification: >= 95% (by SDS PAGE)
• Form/Format: 50 ug in PBS
• Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFHHHHHHHH

• Applicable Applications for COVID-19 recombinant protein: Western Blot Standard, Antibody ELISA, Antigen
• Endotoxin Level: <0.01 EU per 1 ug of the protein by LAL test
• Preparation and Storage: Store at -20 degree C; Stable for 3 months from the date of shipment when kept at 4 degree C.

SDS-Page

(SDS-PAGE: purified recombinant spike RBD (K417N, L452R, T478K) protein of SARS-CoV-2 Delta plus variant)

Related Product Information for COVID-19 recombinant protein

Recombinant spike RBD (K417N, L452R, T478K) protein of human SARS-CoV-2 Delta plus variant expressed and purified from HEK293 cells. There is a C-terminal His-tag.

Severe acute respiratory syndrome coronavirus 2 (SARS?CoV?2) is the virus that causes COVID-19 (coronavirus disease 2019), the respiratory illness responsible for the COVID-19 pandemic. Many SARS-CoV-2 variants have been identified throughout the world since it’s outbreak in late 2019; some are believed or have been believed to be of particular importance due to their potential for increased transmissibility, increased virulence, and reduced effectiveness of vaccines against them.

The genome of SARS-CoV-2 has 89% nucleotide identity with bat SARS-like-CoVZXC21 and 82% with that of human SARS-CoV. The phylogenetic trees of their orf1a/b, Spike, Envelope, Membrane and Nucleoprotein also clustered closely with those of the bat, civet and human SARS coronaviruses. However, the external subdomain of Spike's receptor binding domain (RBD) of SARS-CoV-2 shares only 40% amino acid identity with other SARS-related coronaviruses.