COP9 signalosome complex subunit 7a Recombinant Protein | COPS7A recombinant protein

Recombinant Human COP9 signalosome complex subunit 7a

Cat. Num. AAA1294104

• Gene Names: COPS7A; CSN7; CSN7A; SGN7a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: COP9 signalosome complex subunit 7a; Recombinant Human COP9 signalosome complex subunit 7a; Dermal papilla-derived protein 10; JAB1-containing signalosome subunit 7a; COPS7A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-275aa; Full Length
• Sequence: SAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
• Sequence Length: 275

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for COPS7A recombinant protein

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Product Categories/Family for COPS7A recombinant protein

Cell Biology

References

Polyamine-modulated factor 1 binds to the human homologue of the 7a subunit of the Arabidopsis COP9 signalosome implications in gene expression.Wang Y., Devereux W., Stewart T.M., Casero R.A. Jr.Biochem. J. 366:79-86(2002) Molecular cloning of a dermal papilla derived gene.Ikeda A., Ukai Y., Yamashita M., Yoshimoto M. Cop9 complex subunit 7a.Okaze H., Hayashi A., Kozuma S., Saito T.Molecular cloning and characterization of a novel cDNA encoding human COP9 complex subunit 7a (COPS7a) .Lau S.K., Au T.C.C., Kok L.D.S., Lee C.Y., Tsui S.K.W., Waye M.M.Y., Fung K.P. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.Seeger M., Kraft R., Ferrell K., Bech-Otschir D., Dumdey R., Schade R., Gordon C., Naumann M., Dubiel W.FASEB J. 12:469-478(1998) COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.Bech-Otschir D., Kraft R., Huang X., Henklein P., Kapelari B., Pollmann C., Dubiel W.EMBO J. 20:1630-1639(2001) Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.Lyapina S., Cope G., Shevchenko A., Serino G., Tsuge T., Zhou C., Wolf D.A., Wei N., Shevchenko A., Deshaies R.J.Science 292:1382-1385(2001) Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.Hoareau Alves K., Bochard V., Rety S., Jalinot P.FEBS Lett. 527:15-21(2002) The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.Groisman R., Polanowska J., Kuraoka I., Sawada J., Saijo M., Drapkin R., Kisselev A.F., Tanaka K., Nakatani Y.Cell 113:357-367(2003) Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.Uhle S., Medalia O., Waldron R., Dumdey R., Henklein P., Bech-Otschir D., Huang X., Berse M., Sperling J., Schade R., Dubiel W.EMBO J. 22:1302-1312(2003) Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.Fang L., Wang X., Yamoah K., Chen P.L., Pan Z.Q., Huang L.J. Proteome Res. 7:4914-4925(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 255760064
• NCBI GeneID: 50813
• NCBI Accession #: NP_001157565.1
• NCBI GenBank Nucleotide #: NM_001164093.1
• UniProt Accession #: Q9UBW8; Q9NVX3; Q9UJW4; A8K9A6
• Molecular Weight: 46.1 kDa
• NCBI Official Full Name: COP9 signalosome complex subunit 7a
• NCBI Official Synonym Full Names: COP9 signalosome subunit 7A
• NCBI Official Symbol: COPS7A
• NCBI Official Synonym Symbols: CSN7; CSN7A; SGN7a
• NCBI Protein Information: COP9 signalosome complex subunit 7a
• UniProt Protein Name: COP9 signalosome complex subunit 7a
• Protein Family: COP9 signalosome complex
• UniProt Gene Name: COPS7A
• UniProt Synonym Gene Names: CSN7A; DERP10; SGN7a; Signalosome subunit 7a
• UniProt Entry Name: CSN7A_HUMAN

NCBI Description

This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq, Mar 2014]

Uniprot Description

COPS7A: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Belongs to the CSN7/EIF3M family. CSN7 subfamily.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: cytoplasm; nucleoplasm; signalosome

Molecular Function: protein binding

Biological Process: cullin deneddylation; DNA repair; nucleotide-excision repair; nucleotide-excision repair, DNA damage recognition; transcription-coupled nucleotide-excision repair