Type 4 prepilin-like proteins leader peptide-processing enzyme (comC) Recombinant Protein | comC recombinant protein

Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Type 4 prepilin-like proteins leader peptide-processing enzyme (comC); Recombinant Bacillus subtilis Type 4 prepilin-like proteins leader peptide-processing enzyme (comC); Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (comC); Type 4 prepilin-like proteins leader peptide-processing enzyme; Late competence protein ComC Including the following 2 domains: Leader peptidase EC= 3.4.23.43; Prepilin pep; comC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-248
• Sequence: MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGKCKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIPNRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIGFVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIISFYIKMALG
• Sequence Length: 248

• Species: Bacillus subtilis (strain 168)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 255767643
• NCBI GeneID: 936586
• NCBI Accession #: NP_390685.2
• NCBI GenBank Nucleotide #: NC_000964.3
• UniProt Accession #: P15378
• Molecular Weight: 26,435 Da
• NCBI Official Full Name: membrane protease and transmethylase
• NCBI Official Symbol: comC
• NCBI Protein Information: membrane protease and transmethylase
• UniProt Protein Name: Type 4 prepilin-like proteins leader peptide-processing enzyme
• Protein Family: Competence protein
• UniProt Gene Name: comC
• UniProt Entry Name: LEP4_BACSU

Uniprot Description

Function: Cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally Phe) residue

By similarity.

Catalytic activity: Typically cleaves a -Gly-|-Phe- bond to release an N-terminal, basic peptide of 5-8 residues from type IV prepilin, and then N-methylates the new N-terminal amino group, the methyl donor being S-adenosyl-L-methionine.

Subcellular location: Cell membrane; Multi-pass membrane protein

Probable.

Induction: By several proteins including Spo0A, Spo0H, Sin, AbrB, DegS, DegU, ComA, ComB and ComK.

Sequence similarities: Belongs to the peptidase A24 family.