Collagen alpha-1 (XIII) chain (COL13A1) Recombinant Protein | COL13A1 recombinant protein
Recombinant Human Collagen alpha-1 (XIII) chain (COL13A1), partial
Gene Names
COL13A1; CMS19; COLXIIIA1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-1 (XIII) chain (COL13A1); Recombinant Human Collagen alpha-1 (XIII) chain (COL13A1); partial; COL13A1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
62-717. Partial, provide the complete extracellular domain.
Sequence
HFRTAELQARVLRLEAERGEQQMETAILGRVNQLLDEKWKLHSRRRREAPKTSPGCNCPPGPPGPTGRPGLPGDKGAIGMPGRVGSPGDAGLSIIGPRGPPGQPGTRGFPGFPGPIGLDGKPGHPGPKGDMGLTGPPGQPGPQGQKGEKGQCGEYPHRECLSSMPAALRSSQIIALKLLPLLNSVRLAPPPVIKRRTFQGEQSQASIQGPPGPPGPPGPSGPLGHPGLPGPMGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGAPGIAVAGMKGEPGIPGTKGEKGAEGSPGLPGLLGQKGEKGDAGNSIGGGRGEPGPPGLPGPPGPKGEAGVDGQVGPPGQPGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGIPGQKGEIGLPGPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGEKGETGQAGSPGEKGEAGEKGNPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEKGFQGEKGDRGPLGLPGASGLDGRPGPPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK
Sequence Length
717
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
collagen alpha-1(XIII) chain isoform 1
NCBI Official Synonym Full Names
collagen type XIII alpha 1 chain
NCBI Official Symbol
COL13A1
NCBI Official Synonym Symbols
CMS19; COLXIIIA1
NCBI Protein Information
collagen alpha-1(XIII) chain
Protein Family
NCBI Description
This gene encodes the alpha chain of one of the nonfibrillar collagens. The function of this gene product is not known, however, it has been detected at low levels in all connective tissue-producing cells so it may serve a general function in connective tissues. Unlike most of the collagens, which are secreted into the extracellular matrix, collagen XIII contains a transmembrane domain and the protein has been localized to the plasma membrane. The transcripts for this gene undergo complex and extensive splicing involving at least eight exons. Like other collagens, collagen XIII is a trimer; it is not known whether this trimer is composed of one or more than one alpha chain isomer. A number of alternatively spliced transcript variants have been described, but the full length nature of some of them has not been determined. [provided by RefSeq, Jul 2008]
Research Articles on COL13A1
Similar Products
Product Notes
The COL13A1 (Catalog #AAA1484499) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 62-717. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: HFRTAELQAR VLRLEAERGE QQMETAILGR VNQLLDEKWK LHSRRRREAP KTSPGCNCPP GPPGPTGRPG LPGDKGAIGM PGRVGSPGDA GLSIIGPRGP PGQPGTRGFP GFPGPIGLDG KPGHPGPKGD MGLTGPPGQP GPQGQKGEKG QCGEYPHREC LSSMPAALRS SQIIALKLLP LLNSVRLAPP PVIKRRTFQG EQSQASIQGP PGPPGPPGPS GPLGHPGLPG PMGPPGLPGP PGPKGDPGIQ GYHGRKGERG MPGMPGKHGA KGAPGIAVAG MKGEPGIPGT KGEKGAEGSP GLPGLLGQKG EKGDAGNSIG GGRGEPGPPG LPGPPGPKGE AGVDGQVGPP GQPGDKGERG AAGEQGPDGP KGSKGEPGKG EMVDYNGNIN EALQEIRTLA LMGPPGLPGQ IGPPGAPGIP GQKGEIGLPG PPGHDGEKGP RGKPGDMGPP GPQGPPGKDG PPGVKGENGH PGSPGEKGEK GETGQAGSPG EKGEAGEKGN PGAEVPGLPG PEGPPGPPGL QGVPGPKGEA GLDGAKGEKG FQGEKGDRGP LGLPGASGLD GRPGPPGTPG PIGVPGPAGP KGERGSKGDP GMTGPTGAAG LPGLHGPPGD KGNRGERGKK GSRGPKGDKG DQGAPGLDAP CPLGEDGLPV QGCWNK . It is sometimes possible for the material contained within the vial of "Collagen alpha-1 (XIII) chain (COL13A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
