Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Collagen alpha-1 (VI) chain (COL6A1) Recombinant Protein | COL6A1 recombinant protein

Recombinant Chicken Collagen alpha-1 (VI) chain (COL6A1), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-1 (VI) chain (COL6A1); Recombinant Chicken Collagen alpha-1 (VI) chain (COL6A1); partial; COL6A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
37-233; Partial.
Sequence
DLFFVLDTSESVALRVKPFGDLVAQVKDFTNRFIDKLTERYFRCDRFLAWNAGALHYSDSVVIIKDLTAMPSGRAELKNSVSAINYIGKGTHTDCAIKQGIERLLLGGSHLKENKYLIVVTDGHPLEGYKEPCGGLDDAANEAKHLGIKVFSVAISPHHLDQRLNIIATDHAYRRNFTATSLKP TRDLDVEETINNI
Sequence Length
233
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for COL6A1 recombinant protein
The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. This protein is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107,984 Da
NCBI Official Full Name
collagen alpha-1(VI) chain
NCBI Official Synonym Full Names
collagen type VI alpha 1 chain
NCBI Official Symbol
COL6A1
NCBI Protein Information
collagen alpha-1(VI) chain
UniProt Protein Name
Collagen alpha-1(VI) chain
Protein Family
UniProt Gene Name
COL6A1

Uniprot Description

Collagen VI acts as a cell-binding protein.

Similar Products

Product Notes

The COL6A1 col6a1 (Catalog #AAA953796) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 37-233; Partial. The amino acid sequence is listed below: DLFFVLDTSE SVALRVKPFG DLVAQVKDFT NRFIDKLTER YFRCDRFLAW NAGALHYSDS VVIIKDLTAM PSGRAELKNS VSAINYIGKG THTDCAIKQG IERLLLGGSH LKENKYLIVV TDGHPLEGYK EPCGGLDDAA NEAKHLGIKV FSVAISPHHL DQRLNIIATD HAYRRNFTAT SLKP TRDLDVEETI NNI . It is sometimes possible for the material contained within the vial of "Collagen alpha-1 (VI) chain (COL6A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.