Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Collagen alpha-1(I) chain Recombinant Protein | Col1a1 recombinant protein

Recombinant Rat Collagen alpha-1(I) chain

Gene Names
Col1a1; COLIA1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-1(I) chain; Recombinant Rat Collagen alpha-1(I) chain; Alpha-1 type I collagen; Col1a1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
955-1207aa; Partial of the full length of 152-1207aa
Sequence
QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA
Sequence Length
1453
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for Col1a1 recombinant protein
Type I collagen is a mber of group I collagen (fibrillar forming collagen).
References
Expression of collagen alpha1(I) mRNA variants during tooth and bone formation in the rat.Brandsten C., Lundmark C., Christersson C., Hammarstroem L., Wurtz T.J. Dent. Res. 78:11-19(1999) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Comparative sequence studies of rat skin and tendon collagen. II. The absence of a short sequence at the amino terminus of the skin alpha-1 chain.Bornstein P.Biochemistry 8:63-71(1969) The amino acid sequence of peptides from the cross-linking region of rat skin collagen.Kang A.H., Bornstein P., Piez K.A.Biochemistry 6:788-795(1967) The incomplete hydroxylation of individual prolyl residues in collagen.Bornstein P.J. Biol. Chem. 242:2572-2574(1967) Chemical studies on the cyanogen bromide peptides of rat skin collagen. Amino acid sequence of alpha 1-CB4.Butler W.T., Ponds S.L.Biochemistry 10:2076-2081(1971) Chemical studies on the cyanogen bromide peptides of rat skin collagen. The covalent structure of alpha 1-CB5, the major hexose-containing cyanogen bromide peptide of alpha 1.Butler W.T.Biochemistry 9:44-50(1970) Structure of rat skin collagen alpha 1-CB8. Amino acid sequence of the hydroxylamine-produced fragment HA1.Balian G., Click E.M., Bornstein P.Biochemistry 10:4470-4478(1971) Structure of rat skin collagen alpha 1-CBB. Amino acid sequence of the hydroxyl amine-produced fragment HA2.Balian G., Click E.M., Hermodson M.A., Bornstein P.Biochemistry 11:3798-3806(1972) Chemical studies on the cyanogen bromide peptides of rat skin collagen. Amino acid sequence of alpha 1-CB3.Butler W.T., Underwood S.P., Finch J.E. Jr.Biochemistry 13:2946-2953(1974) Construction of DNA sequences complementary to rat alpha 1 and alpha 2 collagen mRNA and their use in studying the regulation of type I collagen synthesis by 1,25-dihydroxyvitamin D.Genovese C., Rowe D., Kream B.Biochemistry 23:6210-6216(1984) Structural and immunogenic properties of a major antigenic determinant in neutral salt-extracted rat-skin collagen.Stoltz M., Timpl R., Furthmayr H., Kuehn K.Eur. J. Biochem. 37:287-294(1973) Non-helical regions in rat collagen alpha 1-chain.Stoltz M., Timpl R., Kuehn K.FEBS Lett. 26:61-65(1972) Endo180 binds to the C-terminal region of type I collagen.Thomas E.K., Nakamura M., Wienke D., Isacke C.M., Pozzi A., Liang P.J. Biol. Chem. 280:22596-22605(2005) A new procedure for rapid, high yield purification of Type I collagen for tissue engineering.Xiong X., Ghosh R., Hiller E., Drepper F., Knapp B., Brunner H., Rupp S.Process Biochem. 44:1200-1212(2009) Microfibrillar structure of type I collagen in situ.Orgel J.P.R.O., Irving T.C., Miller A., Wess T.J.Proc. Natl. Acad. Sci. U.S.A. 103:9001-9005(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.4 kDa
NCBI Official Full Name
collagen alpha-1(I) chain
NCBI Official Synonym Full Names
collagen, type I, alpha 1
NCBI Official Symbol
Col1a1
NCBI Official Synonym Symbols
COLIA1
NCBI Protein Information
collagen alpha-1(I) chain
UniProt Protein Name
Collagen alpha-1(I) chain
Protein Family
UniProt Gene Name
Col1a1
UniProt Entry Name
CO1A1_RAT

NCBI Description

extracellular matrix collagen protein [RGD, Feb 2006]

Uniprot Description

COL1A1: Type I collagen is a member of group I collagen (fibrillar forming collagen). Defects in COL1A1 are the cause of Caffey disease (CAFFD); also known as infantile cortical hyperostosis. Caffey disease is characterized by an infantile episode of massive subperiosteal new bone formation that typically involves the diaphyses of the long bones, mandible, and clavicles. The involved bones may also appear inflamed, with painful swelling and systemic fever often accompanying the illness. The bone changes usually begin before 5 months of age and resolve before 2 years of age. Defects in COL1A1 are a cause of Ehlers-Danlos syndrome type 1 (EDS1); also known as Ehlers-Danlos syndrome gravis. EDS is a connective tissue disorder characterized by hyperextensible skin, atrophic cutaneous scars due to tissue fragility and joint hyperlaxity. EDS1 is the severe form of classic Ehlers-Danlos syndrome. Defects in COL1A1 are the cause of Ehlers-Danlos syndrome type 7A (EDS7A); also known as autosomal dominant Ehlers-Danlos syndrome type VII. EDS is a connective tissue disorder characterized by hyperextensible skin, atrophic cutaneous scars due to tissue fragility and joint hyperlaxity. EDS7A is marked by bilateral congenital hip dislocation, hyperlaxity of the joints, and recurrent partial dislocations. Defects in COL1A1 are a cause of osteogenesis imperfecta type 1 (OI1). A dominantly inherited connective tissue disorder characterized by bone fragility and blue sclerae. Osteogenesis imperfecta type 1 is non-deforming with normal height or mild short stature, and no dentinogenesis imperfecta. Defects in COL1A1 are a cause of osteogenesis imperfecta type 2 (OI2); also known as osteogenesis imperfecta congenita. A connective tissue disorder characterized by bone fragility, with many perinatal fractures, severe bowing of long bones, undermineralization, and death in the perinatal period due to respiratory insufficiency. Defects in COL1A1 are a cause of osteogenesis imperfecta type 3 (OI3). A connective tissue disorder characterized by progressively deforming bones, very short stature, a triangular face, severe scoliosis, grayish sclera, and dentinogenesis imperfecta. Defects in COL1A1 are a cause of osteogenesis imperfecta type 4 (OI4); also known as osteogenesis imperfecta with normal sclerae. A connective tissue disorder characterized by moderately short stature, mild to moderate scoliosis, grayish or white sclera and dentinogenesis imperfecta. Genetic variations in COL1A1 are a cause of susceptibility to osteoporosis (OSTEOP); also known as involutional or senile osteoporosis or postmenopausal osteoporosis. Osteoporosis is characterized by reduced bone mass, disruption of bone microarchitecture without alteration in the composition of bone. Osteoporotic bones are more at risk of fracture. A chromosomal aberration involving COL1A1 is found in dermatofibrosarcoma protuberans. Translocation t(17;22)(q22;q13) with PDGF. Belongs to the fibrillar collagen family.

Protein type: Extracellular matrix; Secreted, signal peptide; Secreted

Cellular Component: collagen; collagen type I; cytoplasm; endoplasmic reticulum; extracellular matrix; extracellular region; extracellular space; Golgi apparatus; proteinaceous extracellular matrix; secretory granule

Molecular Function: extracellular matrix structural constituent; identical protein binding; metal ion binding; platelet-derived growth factor binding; protein binding

Biological Process: blood vessel development; collagen biosynthetic process; collagen fibril organization; embryonic skeletal development; endochondral ossification; intramembranous ossification; ossification; osteoblast differentiation; positive regulation of cell migration; positive regulation of transcription, DNA-dependent; protein transport; response to cAMP; response to corticosteroid stimulus; response to drug; response to estradiol stimulus; response to hydrogen peroxide; response to hyperoxia; response to mechanical stimulus; response to nutrient; response to nutrient levels; response to peptide hormone stimulus; response to steroid hormone stimulus; sensory perception of sound; skeletal development; skeletal morphogenesis; skin development; skin morphogenesis; visual perception; wound healing

Research Articles on Col1a1

Similar Products

Product Notes

The Col1a1 col1a1 (Catalog #AAA1265510) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 955-1207aa; Partial of the full length of 152-1207aa. The amino acid sequence is listed below: QRGERGFPGL PGPSGEPGKQ GPSGASGERG PPGPMGPPGL AGPPGESGRE GSPGAEGSPG RDGAPGAKGD RGETGPAGPP GAPGAPGAPG PVGPAGKNGD RGETGPAGPA GPIGPAGARG PAGPQGPRGD KGETGEQGDR GIKGHRGFSG LQGPPGSPGS PGEQGPSGAS GPAGPRGPPG SAGSPGKDGL NGLPGPIGPP GPRGRTGDSG PAGPPGPPGP PGPPGPPSGG YDFSFLPQPP QEKSQDGGRY YRA. It is sometimes possible for the material contained within the vial of "Collagen alpha-1(I) chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.