Cytochrome b (COB) Recombinant Protein | cob recombinant protein
Recombinant Debaryomyces hansenii Cytochrome b (COB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b (COB); Recombinant Debaryomyces hansenii Cytochrome b (COB); Recombinant Cytochrome b (COB); Cytochrome b; Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; cob recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-383
Sequence
MTIRKSNPYLSLVNSYLMDSPQPSSMNYWWNVGSLLGLCLVMQMASGMFLAMHYSSSMELAFNSVEHMMRDVNAGWLMRYIHANGASFFFMCLYLHMGKALYYGSYKSPRVLVWSMGVMMFMLTMATAFMGYCLVYGQMSHWGATVITNLLSAMPFMGGDLVPFIWGGFSVSNPTMQRFFALHYLLPFILAALVVMHFMALHVHGSSNPMGMSGNMDRLPMHGYFVFKDLMTVFVFILMFSLFVFYSPNTLGHSDNYMPANPMVTPPSIVPEWYLLPFYAMLRSMPDKLGGVMAMFAALLMLLMLPMTDRSVMRGNTFKMLSKLSFYLFLFNFFLLMNMGQLHVEVPFIELGQFATVYYFSYFLMLVPVMSSMENMLFYMGNK
Sequence Length
383
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,891 Da
NCBI Official Full Name
apocytochrome b
NCBI Official Symbol
cob
NCBI Protein Information
apocytochrome b; endonuclease
UniProt Protein Name
Cytochrome b
Protein Family
UniProt Gene Name
COB
UniProt Synonym Gene Names
CYTB
UniProt Entry Name
CYB_DEBHA
Uniprot Description
Function: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis
By similarity.
Cofactor: Binds 2 heme groups non-covalently
By similarity.
Subunit structure: Fungal cytochrome b-c1 complex contains 10 subunits; 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins. Cytochrome b-c1 complex is a homodimer
By similarity.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein
By similarity.
Miscellaneous: Heme 1 (or BL or b562) is low-potential and absorbs at about 562 nm, and heme 2 (or BH or b566) is high-potential and absorbs at about 566 nm
By similarity.
Sequence similarities: Belongs to the cytochrome b family.
Similar Products
Product Notes
The cob cob (Catalog #AAA1176785) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-383. The amino acid sequence is listed below: MTIRKSNPYL SLVNSYLMDS PQPSSMNYWW NVGSLLGLCL VMQMASGMFL AMHYSSSMEL AFNSVEHMMR DVNAGWLMRY IHANGASFFF MCLYLHMGKA LYYGSYKSPR VLVWSMGVMM FMLTMATAFM GYCLVYGQMS HWGATVITNL LSAMPFMGGD LVPFIWGGFS VSNPTMQRFF ALHYLLPFIL AALVVMHFMA LHVHGSSNPM GMSGNMDRLP MHGYFVFKDL MTVFVFILMF SLFVFYSPNT LGHSDNYMPA NPMVTPPSIV PEWYLLPFYA MLRSMPDKLG GVMAMFAALL MLLMLPMTDR SVMRGNTFKM LSKLSFYLFL FNFFLLMNMG QLHVEVPFIE LGQFATVYYF SYFLMLVPVM SSMENMLFYM GNK. It is sometimes possible for the material contained within the vial of "Cytochrome b (COB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
