SDS-Page
Connector enhancer of kinase suppressor of ras 2 (CNKSR2) Recombinant Protein | CNKSR2 recombinant protein
Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2) , partial
Gene Names
CNKSR2; CNK2; KSR2; MAGUIN; MRXSHG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Connector enhancer of kinase suppressor of ras 2 (CNKSR2); Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2); partial; CNKSR2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
650-800aa, Full Length of Mature Protein
Sequence
AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI
Sequence Length
1,004
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for CNKSR2 recombinant protein
This gene encodes a multidomain protein that functions as a scaffold protein to mediate the mitogen-activated protein kinase pathways downstream from Ras. This gene product is induced by vitamin D and inhibits apoptosis in certain cancer cells. It may also play a role in ternary complex assembly of synaptic proteins at the postsynaptic membrane and coupling of signal transduction to membrane
cytoskeletal remodeling. Multiple transcript variants encoding different isoforms have been found for this gene.
cytoskeletal remodeling. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for CNKSR2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.1 kDa
NCBI Official Full Name
connector enhancer of kinase suppressor of ras 2 isoform 2
NCBI Official Synonym Full Names
connector enhancer of kinase suppressor of Ras 2
NCBI Official Symbol
CNKSR2
NCBI Official Synonym Symbols
CNK2; KSR2; MAGUIN; MRXSHG
NCBI Protein Information
connector enhancer of kinase suppressor of ras 2
UniProt Protein Name
Connector enhancer of kinase suppressor of ras 2
Protein Family
UniProt Gene Name
CNKSR2
UniProt Synonym Gene Names
CNK2; KIAA0902; KSR2; Connector enhancer of KSR 2; CNK2
NCBI Description
This gene encodes a multidomain protein that functions as a scaffold protein to mediate the mitogen-activated protein kinase pathways downstream from Ras. This gene product is induced by vitamin D and inhibits apoptosis in certain cancer cells. It may also play a role in ternary complex assembly of synaptic proteins at the postsynaptic membrane and coupling of signal transduction to membrane/cytoskeletal remodeling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Uniprot Description
May function as an adapter protein or regulator of Ras signaling pathways.
Research Articles on CNKSR2
Similar Products
Product Notes
The CNKSR2 cnksr2 (Catalog #AAA1352403) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 650-800aa, Full Length of Mature Protein. The amino acid sequence is listed below: AAEHLDDMNR WLNRINMLTA GYAERERIKQ EQDYWSESDK EEADTPSTPK QDSPPPPYDT YPRPPSMSCA SPYVEAKHSR LSSTETSQSQ SSHEEFRQEV TGSSAVSPIR KTASQRRSWQ DLIETPLTSS GLHYLQTLPL EDSVFSDSAA I. It is sometimes possible for the material contained within the vial of "Connector enhancer of kinase suppressor of ras 2 (CNKSR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
