Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Kynurenine 3-monooxygenase (cn) Recombinant Protein | cn recombinant protein

Recombinant Drosophila melanogaster Kynurenine 3-monooxygenase (cn)

Gene Names
cn; CG1555; DmelCG1555; Dmelcn
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kynurenine 3-monooxygenase (cn); Recombinant Drosophila melanogaster Kynurenine 3-monooxygenase (cn); Recombinant Kynurenine 3-monooxygenase (cn); Kynurenine 3-monooxygenase EC= 1.14.13.9; Kynurenine 3-hydroxylase Protein cinnabar; cn recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-465
Sequence
MSPGIVSQEVNGRQEPTEAARDERHGRRRRVAVIGAGLVGSLAALNFARMGNHVDLYEYREDIRQALVVQGRSINLALSQRGRKALAAVGLEQEVLATAIPMRGRMLHDVRGNSSVVLYDPINNQCLYSVGRRQLNEVLLNACDKLPNIRCHFEHKLTSANLREGSMEFRNPAKEAVAAHADLIVGCDGAFSSVRQNNVRLPGFNYSQEYIETGYLELCIPSKSGDFQMPANYLHIWPRNTFMMIALPNQDKSFTVTLSMPFEIFAGIQNQNDLLEFFKLNFRDALPLIGEQQLIKDFFKTRPQFLVSIKCRPYHYADKALILGDAAHAMVPYYGQGMNAGMEDVTLLTDILAKQLPLDETLALFTESRWQDAFAICDLAMYNYVEMRDLTKRWTFRLRKWLDTLLFRLFPGWIPLYNSVSFSSMPYRQCIANRKWQDQLLKRIFGATFLAAIVTGGAIYAQRFL
Sequence Length
465
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,882 Da
NCBI Official Full Name
cinnabar, partial
NCBI Official Synonym Full Names
cinnabar
NCBI Official Symbol
cn
NCBI Official Synonym Symbols
CG1555; DmelCG1555; Dmelcn
NCBI Protein Information
CG1555 gene product from transcript CG1555-RA; CG1555-PA; cinnabar; cn-PA
UniProt Protein Name
Kynurenine 3-monooxygenase
UniProt Gene Name
cn
UniProt Entry Name
KMO_DROME

Uniprot Description

Function: Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid

By similarity. HAMAP-Rule MF_03018

Catalytic activity: L-kynurenine + NADPH + O2 = 3-hydroxy-L-kynurenine + NADP+ + H2O. HAMAP-Rule MF_03018

Cofactor: FAD

By similarity. HAMAP-Rule MF_03018

Pathway: Cofactor biosynthesis; NAD(+) biosynthesis; quinolinate from L-kynurenine: step 1/3. HAMAP-Rule MF_03018

Subcellular location: Mitochondrion

By similarity. Membrane; Multi-pass membrane protein

Potential HAMAP-Rule MF_03018.

Sequence similarities: Belongs to the aromatic-ring hydroxylase family. KMO subfamily.

Sequence caution: The sequence AAC47351.1 differs from that shown. Reason: Erroneous initiation. The sequence AAF59196.3 differs from that shown. Reason: Erroneous initiation. The sequence AAK07882.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The cn cn (Catalog #AAA1222129) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-465. The amino acid sequence is listed below: MSPGIVSQEV NGRQEPTEAA RDERHGRRRR VAVIGAGLVG SLAALNFARM GNHVDLYEYR EDIRQALVVQ GRSINLALSQ RGRKALAAVG LEQEVLATAI PMRGRMLHDV RGNSSVVLYD PINNQCLYSV GRRQLNEVLL NACDKLPNIR CHFEHKLTSA NLREGSMEFR NPAKEAVAAH ADLIVGCDGA FSSVRQNNVR LPGFNYSQEY IETGYLELCI PSKSGDFQMP ANYLHIWPRN TFMMIALPNQ DKSFTVTLSM PFEIFAGIQN QNDLLEFFKL NFRDALPLIG EQQLIKDFFK TRPQFLVSIK CRPYHYADKA LILGDAAHAM VPYYGQGMNA GMEDVTLLTD ILAKQLPLDE TLALFTESRW QDAFAICDLA MYNYVEMRDL TKRWTFRLRK WLDTLLFRLF PGWIPLYNSV SFSSMPYRQC IANRKWQDQL LKRIFGATFL AAIVTGGAIY AQRFL. It is sometimes possible for the material contained within the vial of "Kynurenine 3-monooxygenase (cn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.