Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-type lectin domain family 9 member A Recombinant Protein | Clec9a recombinant protein

C-type lectin domain family 9 member A

Gene Names
Clec9a; RGD1562513
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-type lectin domain family 9 member A; Clec9a recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-241aa; full length protein
Sequence
MHEEEIYTSLQWDIPTSEASQKCPSLSKCPGTWCIVTVISCVVCVGLLAASIFLGIKFSQVSSLVMEQRERLIRQDTALLNLTEWQRNHTLQLKSCQASLQRSLRSGSNCNPCPPNWIQNGKSCYYAFDRWETWNNSKKSCLKEGDSLLQIDSKEEMEFINLSIWKLKGGYEYWVGVFQDGPSGSWFWEDGSSPLSDLLPTDRQLSASQICGYLKDHTLISDNCSNWKYFICEKKAFGSCI
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Clec9a recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Clec9a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,429 Da
NCBI Official Full Name
C-type lectin domain family 9 member A
NCBI Official Synonym Full Names
C-type lectin domain family 9, member A
NCBI Official Symbol
Clec9a
NCBI Official Synonym Symbols
RGD1562513
NCBI Protein Information
C-type lectin domain family 9 member A
UniProt Protein Name
C-type lectin domain family 9 member A
UniProt Gene Name
Clec9a
UniProt Entry Name
CLC9A_RAT

Uniprot Description

Functions as an endocytic receptor on a small subset of myeloid cells specialized for the uptake and processing of material from dead cells. Recognizes filamentous form of actin in association with particular actin-binding domains of cytoskeletal proteins, including spectrin, exposed when cell membranes are damaged, and mediate the cross-presentation of dead-cell associated antigens in a Syk-dependent manner ().

Similar Products

Product Notes

The Clec9a clec9a (Catalog #AAA7042568) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-241aa; full length protein. The amino acid sequence is listed below: MHEEEIYTSL QWDIPTSEAS QKCPSLSKCP GTWCIVTVIS CVVCVGLLAA SIFLGIKFSQ VSSLVMEQRE RLIRQDTALL NLTEWQRNHT LQLKSCQASL QRSLRSGSNC NPCPPNWIQN GKSCYYAFDR WETWNNSKKS CLKEGDSLLQ IDSKEEMEFI NLSIWKLKGG YEYWVGVFQD GPSGSWFWED GSSPLSDLLP TDRQLSASQI CGYLKDHTLI SDNCSNWKYF ICEKKAFGSC I. It is sometimes possible for the material contained within the vial of "C-type lectin domain family 9 member A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.